SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_02794 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_02794
Domain Number 1 Region: 70-162
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-20
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 13-80
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000385
Family Cadherin 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_02794
Sequence length 202
Comment [mRNA] locus=scaffold135:129889:134879:- [translate_table: standard]
Sequence
MPGSTAQTNKFHTFYLQQRGEQSTTWADIKVNHPLDYESIKEYNLTIRVENNGAQQLASE
ATVYIMLEDVNDEIPLFTEREQETVLEGEPVGSKVTQVNAIDKDGTFPNNQVTYYVVNSE
RNEGKDYFEINRETGEIFTKVMFDREKQGAYALEVEARDGAPSARPNGNGQPNSGRWYGK
FYLKAVCARRTDCIARTINSVK
Download sequence
Identical sequences F4W7A4
Aech_02794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]