SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_03053 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_03053
Domain Number 1 Region: 439-580,652-785
Classification Level Classification E-value
Superfamily L domain-like 2.89e-55
Family Ngr ectodomain-like 0.00014
Further Details:      
 
Domain Number 2 Region: 213-420
Classification Level Classification E-value
Superfamily L domain-like 6.24e-44
Family Ngr ectodomain-like 0.00094
Further Details:      
 
Domain Number 3 Region: 2-201
Classification Level Classification E-value
Superfamily L domain-like 2.38e-38
Family Ngr ectodomain-like 0.0062
Further Details:      
 
Domain Number 4 Region: 1058-1247
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-38
Family Laminin G-like module 0.0052
Further Details:      
 
Domain Number 5 Region: 906-949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000671
Family EGF-type module 0.012
Further Details:      
 
Domain Number 6 Region: 984-1026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000359
Family EGF-type module 0.02
Further Details:      
 
Domain Number 7 Region: 825-867
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000692
Family EGF-type module 0.02
Further Details:      
 
Domain Number 8 Region: 866-910
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000838
Family EGF-type module 0.006
Further Details:      
 
Domain Number 9 Region: 952-989
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000902
Family EGF-type module 0.014
Further Details:      
 
Domain Number 10 Region: 1295-1336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000743
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_03053
Sequence length 1411
Comment [mRNA] locus=scaffold159:2414127:2445323:+ [translate_table: standard]
Sequence
RDLQGNNVSVIFKTDFEDMATLHVLLLSNNQIHTIERGAFQDLVAVEKLRLNNNQIRHLP
DLLFSNMMNLKRLDLSHNQIATIGPKTLRGVSALRHLLLDNNVLTCVDEASIRELKDLEI
LMLNNNKLITLGKEMLNGLSHLRTLKLAENAFACDCHLAWLSRHLKTYPRLGQHTRCSSP
AHLKERNLAEVQEHEFKCSGLVERTGSECSAEPQCPHPCKCADGIVDCRENSLTKVPTHL
PEDTTELRLEQNGITEIPPKAFSPYRKLRRIDLSNNQIKKVAADAFHGLKSLESLVLYGN
KITELPAGLFQGLTNLQLLLLNANEISCIRTDLFKDLTSLTLLSLYDNNIRSLANGTFAN
LRSIKTLHLARNPFICDCNLRWLSAYLHAHPIETSGAKCETPKRAQKRKIDSMRDDKFKC
KGDEELLTKRAGECILPGACPAQCTCNGATVDCSNKRLTAIPKDLPLYTSTLLLSNNELD
KIKADGLFEKLPELQHLDLRKNKISRIEASAFQGAHNLTDLLLSENRLREVHNKMFSGLP
SLKTLNLHGNSITCVMPGSFDGMPHIRAINMQGNPLSCNCYLAWFAGWLRKRDIAGITGR
CHDPPRLKDAIIKDIPHHEFKCNNDSVGCLGDDYCPPQCNCAGSVVRCSRSQLTEIPRGI
PPETTELYLDVNDIKTIQPERLNHLRILTRLDLSNNQIGMLSNDTFRNLTKLSHLIISYN
KLQCVQRNALAGLKNLRIISLHGNDISVIPEGAFEDLKSITHLALGSNPLYCDCSMRWLA
EWVKKDYVEPGIARCMEPPAMRDKLLLTTPASAFQCKTKQQPAEVLAKCDLCYTSPCENG
GFCEALPDRQFRCKCTPGYHGDRCQHKIDACYGNPCRNSGTCKVLEEGRFSCDCAPGYKG
LRCESNVDDCANNRCANNATCVDLVQAYRCDCTPGFMGEYCEEKIPFCTKGHDPCENGGR
CVDHKTHYSCECPVGFTGLNCSTNLDDCVDHMCQNGATCIDGINNYECKCAAEYTGRYCE
AAPSTAMLYPQTSPCAHHDCQHGACFQPAPASAADYLCQCHPGYTGKRCEYLTSLSFVDN
SSLVELEPLRTRPEANVTIIFTTTQENGVLLYDGQSDGHIAVEFFNGRVRVSYDVGNYPT
STMYSYEMVADGKPHMAELLAIKKNFTMRVDRGSARSIINEGPKEYLKLVTPMFVGGVAP
EVAKVAFTDFHLRNITSFQGCISEMWINHKLVDFSNAAKMHRVTPGCAASEEEADEARDI
VEAEGINSSGSNEEIIPQEHIPREHSDVIMPVSGLVPSHACIGHECKKGSQCIPSPYGNS
YSCRCQTGWQGRYCEKAPTCRKEHTREYYSENGCRSRRPVKLAKCWGSCGNSCCLPRKTK
RRKVRLICADGMRYTKDVDLVRKCTCTRKCY
Download sequence
Identical sequences F4W9S8
Aech_03053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]