SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_04185 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_04185
Domain Number 1 Region: 2165-2356
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.82e-32
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 1994-2163
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-29
Family Laminin G-like module 0.003
Further Details:      
 
Domain Number 3 Region: 1772-1948
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.8e-25
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 4 Region: 1409-1583
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.58e-22
Family Laminin G-like module 0.0025
Further Details:      
 
Domain Number 5 Region: 1586-1765
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.02e-18
Family Laminin G-like module 0.0062
Further Details:      
 
Domain Number 6 Region: 165-211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000865
Family Laminin-type module 0.0032
Further Details:      
 
Domain Number 7 Region: 726-774
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000273
Family Laminin-type module 0.064
Further Details:      
 
Domain Number 8 Region: 670-719
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000024
Family Laminin-type module 0.0083
Further Details:      
 
Domain Number 9 Region: 214-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000179
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  Aech_04185
Domain Number - Region: 772-812
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000614
Family Laminin-type module 0.017
Further Details:      
 
Domain Number - Region: 322-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00162
Family Laminin-type module 0.093
Further Details:      
 
Domain Number - Region: 267-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00753
Family Laminin-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_04185
Sequence length 2357
Comment [mRNA] locus=scaffold482:204448:236887:- [translate_table: standard]
Sequence
MVMRIITYEPDDAGNPADYDTPLLTAFSSWKRDCAIETNERSAFKSLVVIPTEEERFTIP
SMIVFSRGAPTAVLHDNQMENRAVVRPQALTARFFAVFFYMRRRSGSLPPQELTSVEDRK
CTLRDSLSMCYVALCRNNLVTSNCSDLHNEMPPRKIEAQSIQTGCGCNNLGSTSSACDIV
SGQCQCKPQVIGRQCNECKTGYWGLTSGTGCTPCGCDSMGSHNTSCSNDTGECYCKPGVG
GSRCDSCLSGYYGFSLNGCQLCDSCVRPGHVCDPDTGRCVCPRLTYGEHCDRCRPGAWDL
VPRVGCRLCACTLGATGSQCDHQGQCPCRIGYDGLRCERCAKGYYGYPRCRPCGCNLAGT
THCHDGVCECDDKGQCPCKELVVGRQCNQCKERTFGLATDNVKGCTECFCFGRSTLCQQA
GLSWGQRRLTRPRVLYINDTVSDVIITNFGSTTVLPAVNGGLNVTNGLSVIPGSDGDVTL
PTTLYYNYPLYWRLPDSFLGDKVVSYGGFLRFKTSTEGGIPLRSNLRYPVVQLQGNNKIV
LEYYLHLPVNDNRYEVRFHESLWQLQNRPDYKVSREVLMVALQNLQYIFVKASDNAEFTK
TTLLEASLDAAVLMPTHSPPLATGVEICQCPPEYNGTSCQDPSIGFYRWYKNTTATSTIV
IDLVGQARRCQCNGRSEVCDRETGYCLNCKENTFGAHCNVCTDSFYGHPEIGGCKPCPCP
QVDKRFSSTCVVRANNEPICHCKPGYVGRKCERCAHGYYGFPDLPDGKCVPCNCNLAGSL
SDGCDGETGQCKCKIGSTGRDCSQCTAYRHVYINNVCTSCNDNCTGILLDTVAMLSEELA
GGTSHIADGYIPPPWAELSYIDSNMTTYLEELEQRTRLQQRMRNVPWHEYKKLAQDVETM
LRNMNKNAKYADTLKTKGGDLKNNVFTAKIMLDNLRKDIEGTTSELNQYSNDNRRIEIKK
ALKTAKTILNYLKSVDIAKRTTEVENFLDGVTKYVAWLNSLHDATEPLAVAQNDAKNYEM
KLNDMRTIIENTMETLFSYDSLYNHINGTFIEAKDQCVRIEILRDETNETITEGKKLVNE
ARDLLVNAENNIQNLSDSRDKLTYWTEKLSMKEELLYRLNYEYDEKYVVPAVQHAKNLSS
YVDQYVSLFAKTRDIAASPLKASQAYKNIVDGLQAAKVTALAAKEIIEDVHKKAFPPSGQ
KSLLDNAKEVLTKSSQQWEVAKEHDKLIKNANAKLNAQKQAILVLKDSLNNTGIKDNEIN
VKLRELQSNSKKLHEDLLNILEDNNEVAESVMNTQRLIDDYKQGIADRLKPKLHELKREG
DSKISLASEKLTEALSNIKKADAKLISLSNVAMKRKAVFDKWNDTLATKLQNLKDKIAEA
RNTAEGIRVSLRSVEGKECIRSYRPTTLQSSSTTSIIITFALPTARKEGSLFYLPSGIND
DFIALEIFDKKVRFLWNVGGGTGILTHPEILESGDLQNDRSWYRIEAERTRHTGKLNVHK
QFSTSGKYLPVINTTNSEYGRFDVLPTDRVWIGGIPKSQRRPTELIAGNGLPGCIHQVIL
DGKHIGLWNFITTAPDMACKACVEGVEDAKDDIAYNFNGEGYAVRNRVSSGPYNKYMFGV
SISFRTYDENALLFLAINKDNQHIMISLREGRVILSSTYKYNTGNWTKVDAFRQYQLRKN
IEKCSLSIGGDNDKRIGAPTPQPTKEDIPDLAQAKYYIGGLPPSFRAEKLILPSQVSFLG
CMANIVVQEGYDPMAEQYYGVESSCGNKPLKIVGFYGDGYLEHSAFTLRKIQSVLSFSFR
TMQDAAMLLLSTFEGHEDRLDGTLKEAKDSYYSMCILNGQVQVRLNAGHGELVLQSNNTF
NDGKYHSVTVIKKRKEVELRIDDAYQTSGRLRNSIAIKAPSSNGGLFFGGLPALINNTKM
IATNTPLYGAIKDVIFNDINLRFDDAVNFDHALIGRSGPSMGKETPNYVPSASLSRGMST
QPEGCQKVPYYSLEPGALKFGDKPHSHTQLYLNFKKFWEKKYAIEFDFRTYYPNGLLFIT
PGLRLKHYLMVLIRDGQLLLIVRSKQRKEILFKTPFNDGNWHHVVISHEERKITLLVDTQ
TPRVIKVPRRIGLASMMYIGGLPESGTPIPEQVVVRLETLKGCIRGLKINGNVYDMVGST
SRAFNVGQCFPSVESGAYFQGEAYAIYRNNFEVDGVLELQLEFRTSEVSGVLLSITAPSG
SPSLSLELNSGKVIMSGDLGDNNPLYVEQGFSNHYAICDNRWHRIQAVYNDEELALKVDE
LDQKYGLPTNINYHLNTSIFSGPLYIGGIPATAQKGSLLTRDHFNGCIRNVMIRGERRDW
TDMAELHNIHLSSCPVQ
Download sequence
Identical sequences F4WV88
Aech_04185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]