SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_04403 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_04403
Domain Number 1 Region: 931-1224
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.44e-75
Family Protein kinases, catalytic subunit 0.000000679
Further Details:      
 
Domain Number 2 Region: 280-454
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-31
Family MAM domain 0.0052
Further Details:      
 
Domain Number 3 Region: 85-231
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-16
Family MAM domain 0.0042
Further Details:      
 
Domain Number 4 Region: 238-271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000353
Family LDL receptor-like module 0.0012
Further Details:      
 
Weak hits

Sequence:  Aech_04403
Domain Number - Region: 805-845
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00385
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_04403
Sequence length 1503
Comment [mRNA] locus=scaffold288:1397828:1409926:+ [translate_table: standard]
Sequence
MINDTRRPKLATTIAGYSQTSRTCNRRHVSVYNGDSGRLLFGIVLFCCYITVTCGSKISM
WHGKSFKDLLAAVSSKHSPHYPQMGYCDFDTDCDWSWNDTHGFKKVKARTSLSRAFPNTD
ANNSSNGHFLWFSGKGDAHIWSKSIPRTGPRCRIEFSLYMVEMEIGFINLVIQTNNMSSI
AVTKSGNNSSIWKKISFSLRAIDQSYKLVLEVYVPYPNSSIGVDNLRLVNCFPESIGDCT
EDMFRCNNGSCLNRTRICDFTKDCPDGEDEALECDKIPKNARCNFEDGWCGWANVPERPL
NWTLHKGPTPTERTGPSYDHTYRNETGTYAFVNMASKDMKYGSRGTITSPLYNPTPPYAS
NPKSPYYKSCQVRFFYHKHGPHAASLGLFLVQVRPHGNHTENLWWSYGTNSDIWYNEAVA
LPDIKYRYHLQFEASRGYSSKSDIAIDDISLSRECFGIGVPREVVGNFNYNTPVIESEIM
PAQHPDFVNETVIRITTCAASGRKGPTDEKCTEKYNNTNVELFIPSQEGERFNLYGVQRW
TAPRGEYYTLIAIGARGGLGSSNTGITLGAFVRGVIELQKGDQLYFMVGQEGTDACAKNL
GLKKTACPSNQYADLSLSQASKMREVKKVEFRNPGGGGGGATTIFTLKANGDLEPILIAG
GGGGLGLNPTMDDGLQHGRGPFPMGRLSSSPSNFSERMGGPGASWNGTWPNFQRKAWGTP
LIYGGVGGIGCESGTEIHGDGGFGGGGGGCQSGGGGGGYIGGNAGQNDGNGEGGYSYANQ
KLTDVYFKAAAHSGQGEVFVIPAISGCGCDYRCVALDQYLSETKCLCPQGWLLSNDSKSC
IMADDSKDGHQTYMIQLVVVIIGLLTIIGICLISYKRYQKQKALSHRRQVMFGNGTELAA
LRPGHQSDTMMTEYNPNYEFAGNLYSFKDLPQIPRECIDLVKPLGQGAFGEVFQGVYKYG
GDEHPVAVKTLPSLSTTQAEADFMMEALIMSKFNHPNIVHFIGVSFDKHPRYIVLELLAG
GDLKNFLREERPRSDRPTSLTMLDLIMCGYDIANGCKYMEEARFIHRDIAARNCLLTTKA
PGRTVKIADFGMARDIYRSDYYRKGGKAMLPIKWMPPESFLDGIFTTKTDVWAFGVLLWE
IMSFGYMPYTGCANREVMSMVQSGGRLEKPAGCPDPIYGIMTRCWHPRPDDRPSFSTIAE
RIGYCLQDPDVINKPTPNFDILPHICDREITIMRPDPEAECINVQSNLDSGYIQPRVSDP
RSVARRVDQAMGGTAYDSENEKSIEDKYGESYAKSTGCQQGFSCNTCDSSMDTFEQIYNS
DNDEDHDDDVSENKDKKRINQSDRQENRAIHRNSDIEDHDNIDNGNNRPEDECHMTANID
SAITDRKNGNESTTTTDTNSDSLIAQSSDTPPDTITNSSPNMRSCSSSRIIGLNANVSNV
NGMVKKNTLKATLSLDPSALCRGTIPYEKITTQRLSSSYTPGSKELRKDSLGHELPREEE
CSC
Download sequence
Identical sequences F4WID9
Aech_04403 XP_011053417.1.86870 XP_011053418.1.86870 XP_011053419.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]