SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_04439 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_04439
Domain Number 1 Region: 266-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  Aech_04439
Domain Number - Region: 79-174
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00314
Family Growth factor receptor domain 0.0081
Further Details:      
 
Domain Number - Region: 237-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0559
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_04439
Sequence length 400
Comment [mRNA] locus=scaffold288:1823425:1828360:- [translate_table: standard]
Sequence
MMIPLLFATFLVNFPHQLAQSHSNNGLIRIAVVLGASVLPVGLAAGPRYVPKWKKQACEI
PASQHPNSHYICDEAGEVKCLPGWTGDLCDVPICRKGCDPLQGYCRRPGECRCKLGFYGE
LCDKCVALPGCQHGRCNVSFECSCDPGWKGMFCSEPICAPDCLSSQDVVSGGKALSANSV
RFCRVVFMGPVKGPSSVDAIQVGPDCFVKHRSARKDVAGITVAWTGPNCTECVPYPGCVH
GSCKRPWECRCEPGWAGDLCNEKLTYCEEHLDICRNNATCISMTHEDGDYRCICPLGYMG
RQCQIKTMIPSMELVPPMPDVTMELSQDVQGLGDKPSIEEISNEDNKYGAKPPKEEQTAE
PLGPIVITDPPTTSTVDPAATAGKWPIEEPTTERDDENET
Download sequence
Identical sequences F4WIH1
Aech_04439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]