SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_04815 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_04815
Domain Number 1 Region: 488-936
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.26e-115
Family PIWI domain 0.001
Further Details:      
 
Domain Number 2 Region: 194-508
Classification Level Classification E-value
Superfamily PAZ domain 1.73e-69
Family PAZ domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_04815
Sequence length 936
Comment [mRNA] locus=scaffold344:829385:840656:+ [translate_table: standard]
Sequence
MFASTFIFGRLDRNVVVSDLGDGREGRTKRESIKKKRKLSIDKNVSTRRRKRKSKPWTGI
TKADKFYASAGTAATAATSQQLPHAQASVSTGAVRRPGQPATQSSTGRGLIQRVGEKGDS
ATIGQIGRGLEKLSIQPTAGGSGDAGAGAGAGAVAIVASGRGAARGKRILPADIFVTKPS
HVENKKGTSGTHKVIKVNYFKVLKATDWALYQYRVDFSPEEDRTMVRKALLKVHQKNIGA
YIFDGTVMYTSCRLSDRMVFTSTRQSDEQHITITVRLVGDMLVGDPHYIQFFNILVRKCY
ENLKLKLVGRHYFDPGSKIILPEHKLELWPGYISSIRQHERDILMCVEISNKVMRLETLG
DILNNFYREDHGRFRENFCNAVIGTVVLTDYNNNTYRIEDVDFSASPSSSFPLKNGENIT
YIDYYRKKYDIKIRNSGHPMLVTKSKRKDRQAEEGERVYLVPELCRATGLTDSMRENYRL
MSSLAVETRLQPGKRIEKLLRFNKRLCEERTIKQELSEWNLQLDNKLLQVPARQLLNEKI
YFGGDISANAEQGDWTRAMMNKKCVISPRLKEWVFMISERDRPLEQNFIPTLLKVAAGIQ
FQIDKPKSEYIRDDRPGTYNERLEQILSRQIPQLVFCAVSNNRSDRYSAIKKKCCVDRPV
PSQICLTRTMTHKNIKSIATKIAIQMSCKLGGAPWYVDVPLEGLMMIGFDVCHDTTMRNK
DFGATIATLNRRMTQYFSAVNVHHTGEELSNDLSDNICKSAQAYYALNKTLPGRIVIYRD
GVGEGQVPLVMDREVIQIKKKLDGLYGGPDRYRMAFIIVTKRLNTRFFENNDNPEPGTIV
DDVITSPIKYDFFIVSQKVRQGTVTPTAYSVIYDTLGMDPDKIQRLTYKLTHMYYNCSST
VRVPAPCHYAHKLAFLVSKFIHRAPDTQLQNTLYFL
Download sequence
Identical sequences F4WNM9
XP_011056568.1.86870 Aech_04815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]