SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_04894 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_04894
Domain Number 1 Region: 68-209
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000502
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 2 Region: 180-284
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000847
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 371-503
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000146
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 330-374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000149
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 576-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000569
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 1178-1215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000141
Family EGF-type module 0.05
Further Details:      
 
Domain Number 7 Region: 709-821
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000204
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 8 Region: 889-934
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000372
Family EGF-type module 0.018
Further Details:      
 
Domain Number 9 Region: 1083-1228
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000033
Family Growth factor receptor domain 0.0078
Further Details:      
 
Domain Number 10 Region: 667-705
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000725
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  Aech_04894
Domain Number - Region: 637-673
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000902
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 1643-1674
Classification Level Classification E-value
Superfamily EGF/Laminin 0.013
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 1319-1351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0162
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 1000-1031
Classification Level Classification E-value
Superfamily EGF/Laminin 0.019
Family Laminin-type module 0.099
Further Details:      
 
Domain Number - Region: 539-570
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0193
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 858-903
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0273
Family EGF-type module 0.068
Further Details:      
 
Domain Number - Region: 1600-1650
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0441
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 961-991
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0839
Family EGF-type module 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_04894
Sequence length 1784
Comment [mRNA] locus=scaffold189:302911:314315:+ [translate_table: standard]
Sequence
MKRLWPLLTWILLSSYPAESRKGLGHGSKREVFFLNLEDGYFGCQVNESTDVLQLLELSK
LCDHRVDCYQGVDEQRNKLKCTDYPYTYIITINISTNVTIQRLLGVASRMPLCQCKSGYI
GNGEVHCEDVNECTIPGACGDNTVCHNIPGNYTCTCQDGFTGDPFNSCIDIDECKYEGAC
GRGALCVNVPGAHKCECPDGYDGSPEEECRDVDECLRSPCGRSALCTNVHGSFRCSCPDG
MDGDPMTGCHDINECTTLENPCGKNAICKNEEPGYNCLCPPGYSARSSPTVACDQTDVTT
LCKSNFDCVNNAECIEGQCFCKDGFKAIGAECVDLNECLTNPCGPASICTNTRGSYHCEC
ESGFVGTPPHIPCKAPCDEVTCGEHAFCKADGHEAYCICEDGWTFNPNDIAAGCVDINEC
DAINGPSGRCGKNAICTNTPGGFSCQCKLGYSGNAFKQCIDIDECTKSNVCGHGATCTNI
EGSYSCTCPEETIPDPDPYIKCVGIVRCEIDDDCPGNAICDLQKRCLCPEPNVGNDCRHP
CEDLSCGPNAHCMLLNDVATCLCSNGYTGKPGIKDGCRDINECAINPCPPGAICNNEPGS
FSCQCPSGMTGDPYSGGCQESKTPHVCGPSAPCPAGEQCIKDEFVGSSVCICQRGYTRDH
ETGKCRDINECMELREKPACGVNAICKNLPGSYECQCPPGFNGNPFSLCEECNSIECQCQ
PPYKIVNGKCMLAGCSKGEKCPSGAECITIAGGVSYCACPKGYTTKSDGSCEDINECIVG
HQVCGYGAECINLPGSHQCVCPHGYGGDPYNGLCSPAQKRCTNDHECKANEKCVQPGECV
CPPPFYTDPLDGNLCKNPCDRFPCGINAKCTPSDPPRCMCEAGFEGDPQHGCIDVNECAN
NPCGHGAYCINTKGDHTCECPKGMIGDPYGAGCTGAPTGKSECSSNDDCENYLSCVQGNC
VNPCDNVPCGPNAYCEPDKHAAWCRCVIGFTEGKNNECVSQCDGFVCGTGAQCIVSYDGP
TCKCIEGFMGNPFPGGQCVPDVCSPEIPCAEPSVCISGRCKRRCEGVICGIGAMCDPLTN
KCVCNPYFVGNPDLLCMPPIQPPHCDPFCGKNAHCEYGLQESKCVCNPGTSGNPYHGCGV
QEKSDCSTAVCGKDAHCNAGPNAVECLCPSGFAGNPYIQCFDINECNGNACGSNAVCINT
LGSYDCRCKDGFFGNPFVGCQQVQVGPCSDPSTCVCSNTVLCPFDYICVNHKCINQCSDI
KCGPRSVCQNGVCVCPPGYSGNPNDLHKGCHLHGHCLNDLECEPQEICFQVGKGVRKCVD
ACSKLQCGPNALCITQNHVSSCLCIDGYQGNPSNLIEGCQPSKSVIPGCAHDSDCPVGSF
CITLDGGVRDCVNPCNKVVCGAYQKCEPDLVVPGHATCKCQDGYEWNPVQSSCEKPSVPD
CITDDDCHSSEGCRPDALGVLKCVSLCDGFTCTANSRCVMENHHGRCDCLPGYIGNPNDR
RGCHSPRENRCSTDSECAEDQTCRSAPDGPLACQLVCDFITCGPNALCVVNNHVANCECP
PGQYAGDPNDSTSGCRAVPCVYNIDCPPAQLCNRLTHTCYDACDENACGVNAVCIAEDHK
AICQCPPGLRPNPVPDVECVAVEACHPDSCHPTALCVAGPTNNPVCQCPPNHVGDPYVNG
CQPEGHCSSPKDCPVHSVCHEHRCINPCENACGPNAFCEIVNDQPSCKCIHRFVPSSRGP
EHGCVRGTNYCTVDAQCEDSYCIDGQCRGNPDLIDKQLIIMITL
Download sequence
Identical sequences F4WBN6
Aech_04894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]