SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_04895 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_04895
Domain Number 1 Region: 135-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000583
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 2 Region: 298-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000138
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 3 Region: 8410-8433
Classification Level Classification E-value
Superfamily DPY module 0.00000706
Family DPY module 0.00085
Further Details:      
 
Domain Number 4 Region: 6617-6640
Classification Level Classification E-value
Superfamily DPY module 0.00000732
Family DPY module 0.00081
Further Details:      
 
Domain Number 5 Region: 7991-8014
Classification Level Classification E-value
Superfamily DPY module 0.00000745
Family DPY module 0.0011
Further Details:      
 
Domain Number 6 Region: 2936-2959
Classification Level Classification E-value
Superfamily DPY module 0.00000824
Family DPY module 0.0015
Further Details:      
 
Domain Number 7 Region: 4823-4846
Classification Level Classification E-value
Superfamily DPY module 0.0000111
Family DPY module 0.0014
Further Details:      
 
Domain Number 8 Region: 8623-8646
Classification Level Classification E-value
Superfamily DPY module 0.0000114
Family DPY module 0.0013
Further Details:      
 
Domain Number 9 Region: 6196-6219
Classification Level Classification E-value
Superfamily DPY module 0.0000115
Family DPY module 0.0013
Further Details:      
 
Domain Number 10 Region: 8517-8540
Classification Level Classification E-value
Superfamily DPY module 0.0000144
Family DPY module 0.0012
Further Details:      
 
Domain Number 11 Region: 7144-7167
Classification Level Classification E-value
Superfamily DPY module 0.0000157
Family DPY module 0.0013
Further Details:      
 
Domain Number 12 Region: 8833-8856
Classification Level Classification E-value
Superfamily DPY module 0.0000157
Family DPY module 0.0012
Further Details:      
 
Domain Number 13 Region: 4613-4636
Classification Level Classification E-value
Superfamily DPY module 0.000017
Family DPY module 0.0012
Further Details:      
 
Domain Number 14 Region: 5350-5373
Classification Level Classification E-value
Superfamily DPY module 0.000017
Family DPY module 0.00093
Further Details:      
 
Domain Number 15 Region: 6300-6323
Classification Level Classification E-value
Superfamily DPY module 0.0000183
Family DPY module 0.0013
Further Details:      
 
Domain Number 16 Region: 9041-9064
Classification Level Classification E-value
Superfamily DPY module 0.0000183
Family DPY module 0.0011
Further Details:      
 
Domain Number 17 Region: 9347-9369
Classification Level Classification E-value
Superfamily DPY module 0.0000209
Family DPY module 0.0012
Further Details:      
 
Domain Number 18 Region: 4110-4256
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000022
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 19 Region: 7779-7802
Classification Level Classification E-value
Superfamily DPY module 0.0000222
Family DPY module 0.001
Further Details:      
 
Domain Number 20 Region: 6936-6958
Classification Level Classification E-value
Superfamily DPY module 0.0000248
Family DPY module 0.0013
Further Details:      
 
Domain Number 21 Region: 4406-4429
Classification Level Classification E-value
Superfamily DPY module 0.0000262
Family DPY module 0.0016
Further Details:      
 
Domain Number 22 Region: 8099-8122
Classification Level Classification E-value
Superfamily DPY module 0.0000275
Family DPY module 0.001
Further Details:      
 
Domain Number 23 Region: 2193-2216
Classification Level Classification E-value
Superfamily DPY module 0.0000288
Family DPY module 0.0014
Further Details:      
 
Domain Number 24 Region: 5138-5161
Classification Level Classification E-value
Superfamily DPY module 0.0000288
Family DPY module 0.0011
Further Details:      
 
Domain Number 25 Region: 3568-3591
Classification Level Classification E-value
Superfamily DPY module 0.0000366
Family DPY module 0.0015
Further Details:      
 
Domain Number 26 Region: 1614-1758
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000377
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 27 Region: 5035-5058
Classification Level Classification E-value
Superfamily DPY module 0.0000392
Family DPY module 0.0013
Further Details:      
 
Domain Number 28 Region: 5670-5693
Classification Level Classification E-value
Superfamily DPY module 0.0000392
Family DPY module 0.0019
Further Details:      
 
Domain Number 29 Region: 2297-2320
Classification Level Classification E-value
Superfamily DPY module 0.0000484
Family DPY module 0.0013
Further Details:      
 
Domain Number 30 Region: 3879-3902
Classification Level Classification E-value
Superfamily DPY module 0.0000484
Family DPY module 0.0014
Further Details:      
 
Domain Number 31 Region: 8201-8224
Classification Level Classification E-value
Superfamily DPY module 0.0000497
Family DPY module 0.0015
Further Details:      
 
Domain Number 32 Region: 1986-2009
Classification Level Classification E-value
Superfamily DPY module 0.0000549
Family DPY module 0.0016
Further Details:      
 
Domain Number 33 Region: 7674-7697
Classification Level Classification E-value
Superfamily DPY module 0.0000615
Family DPY module 0.0015
Further Details:      
 
Domain Number 34 Region: 7885-7908
Classification Level Classification E-value
Superfamily DPY module 0.0000654
Family DPY module 0.0017
Further Details:      
 
Domain Number 35 Region: 7569-7592
Classification Level Classification E-value
Superfamily DPY module 0.000068
Family DPY module 0.0016
Further Details:      
 
Domain Number 36 Region: 6403-6426
Classification Level Classification E-value
Superfamily DPY module 0.0000759
Family DPY module 0.0013
Further Details:      
 
Domain Number 37 Region: 3252-3275
Classification Level Classification E-value
Superfamily DPY module 0.0000798
Family DPY module 0.0014
Further Details:      
 
Domain Number 38 Region: 4932-4955
Classification Level Classification E-value
Superfamily DPY module 0.0000798
Family DPY module 0.0014
Further Details:      
 
Domain Number 39 Region: 8305-8328
Classification Level Classification E-value
Superfamily DPY module 0.0000824
Family DPY module 0.0016
Further Details:      
 
Domain Number 40 Region: 3673-3696
Classification Level Classification E-value
Superfamily DPY module 0.0000915
Family DPY module 0.0011
Further Details:      
 
Weak hits

Sequence:  Aech_04895
Domain Number - Region: 5566-5589
Classification Level Classification E-value
Superfamily DPY module 0.000103
Family DPY module 0.0011
Further Details:      
 
Domain Number - Region: 9258-9280
Classification Level Classification E-value
Superfamily DPY module 0.000107
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 7252-7275
Classification Level Classification E-value
Superfamily DPY module 0.000114
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 3147-3170
Classification Level Classification E-value
Superfamily DPY module 0.000116
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 4304-4327
Classification Level Classification E-value
Superfamily DPY module 0.000118
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 9150-9173
Classification Level Classification E-value
Superfamily DPY module 0.000126
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 3984-4007
Classification Level Classification E-value
Superfamily DPY module 0.000127
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 5457-5480
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 2090-2113
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 3461-3484
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 5878-5901
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0011
Further Details:      
 
Domain Number - Region: 2945-3103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000188
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 8934-8957
Classification Level Classification E-value
Superfamily DPY module 0.000196
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 3775-3798
Classification Level Classification E-value
Superfamily DPY module 0.000222
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 6509-6532
Classification Level Classification E-value
Superfamily DPY module 0.000222
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 6161-6255
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000235
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 659-707
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000246
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 4091-4114
Classification Level Classification E-value
Superfamily DPY module 0.000262
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 4509-4532
Classification Level Classification E-value
Superfamily DPY module 0.000262
Family DPY module 0.0024
Further Details:      
 
Domain Number - Region: 5243-5266
Classification Level Classification E-value
Superfamily DPY module 0.000275
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 2399-2422
Classification Level Classification E-value
Superfamily DPY module 0.000288
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 6833-6856
Classification Level Classification E-value
Superfamily DPY module 0.000301
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 9900-9922
Classification Level Classification E-value
Superfamily DPY module 0.000353
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 3359-3382
Classification Level Classification E-value
Superfamily DPY module 0.000366
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 5773-5796
Classification Level Classification E-value
Superfamily DPY module 0.000379
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 7366-7526
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000439
Family Growth factor receptor domain 0.0054
Further Details:      
 
Domain Number - Region: 7039-7062
Classification Level Classification E-value
Superfamily DPY module 0.000445
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 2523-2672
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000502
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 2622-2781
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000596
Family Growth factor receptor domain 0.0071
Further Details:      
 
Domain Number - Region: 4718-4741
Classification Level Classification E-value
Superfamily DPY module 0.000641
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 7708-7839
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000753
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number - Region: 9712-9733
Classification Level Classification E-value
Superfamily DPY module 0.000772
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 5995-6147
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000989
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number - Region: 8478-8511
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00128
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 1883-1905
Classification Level Classification E-value
Superfamily DPY module 0.00131
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 9216-9249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00149
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 10039-10062
Classification Level Classification E-value
Superfamily DPY module 0.0017
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 8631-8788
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00188
Family Growth factor receptor domain 0.007
Further Details:      
 
Domain Number - Region: 10105-10127
Classification Level Classification E-value
Superfamily DPY module 0.00196
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 3576-3732
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00298
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 10545-10567
Classification Level Classification E-value
Superfamily DPY module 0.00379
Family DPY module 0.0024
Further Details:      
 
Domain Number - Region: 10739-10759
Classification Level Classification E-value
Superfamily DPY module 0.00392
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 7953-7986
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00583
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 6578-6611
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0062
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 9511-9534
Classification Level Classification E-value
Superfamily DPY module 0.00693
Family DPY module 0.0035
Further Details:      
 
Domain Number - Region: 7048-7203
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00785
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 4472-4504
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00911
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 5422-5516
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0102
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number - Region: 8894-8929
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0113
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 3421-3455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0113
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 2792-2824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0142
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 8315-8469
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0149
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 1841-1875
Classification Level Classification E-value
Superfamily EGF/Laminin 0.016
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 7318-7355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0179
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 9112-9144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0181
Family EGF-type module 0.068
Further Details:      
 
Domain Number - Region: 6734-6892
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 6367-6398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0211
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 7001-7032
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0215
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 9770-9793
Classification Level Classification E-value
Superfamily DPY module 0.0248
Family DPY module 0.0031
Further Details:      
 
Domain Number - Region: 346-367
Classification Level Classification E-value
Superfamily DPY module 0.0275
Family DPY module 0.0031
Further Details:      
 
Domain Number - Region: 2899-2931
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0288
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 10293-10315
Classification Level Classification E-value
Superfamily DPY module 0.0288
Family DPY module 0.0036
Further Details:      
 
Domain Number - Region: 7637-7669
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 8587-8618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 9575-9597
Classification Level Classification E-value
Superfamily DPY module 0.0353
Family DPY module 0.0028
Further Details:      
 
Domain Number - Region: 2052-2085
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0357
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 8063-8156
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0361
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number - Region: 1424-1458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0364
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 5528-5561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0377
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 4679-4712
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0401
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 1468-1489
Classification Level Classification E-value
Superfamily DPY module 0.0484
Family DPY module 0.0036
Further Details:      
 
Domain Number - Region: 3214-3247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0502
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 407-428
Classification Level Classification E-value
Superfamily DPY module 0.051
Family DPY module 0.0037
Further Details:      
 
Domain Number - Region: 6412-6568
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0549
Family Growth factor receptor domain 0.0087
Further Details:      
 
Domain Number - Region: 10484-10504
Classification Level Classification E-value
Superfamily DPY module 0.0549
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 5148-5302
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0596
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number - Region: 3531-3563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0614
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 8269-8300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.062
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 2835-2856
Classification Level Classification E-value
Superfamily DPY module 0.0654
Family DPY module 0.0034
Further Details:      
 
Domain Number - Region: 2362-2394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0656
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 4783-4818
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0678
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 2259-2292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0692
Family EGF-type module 0.06
Further Details:      
 
Domain Number - Region: 10222-10245
Classification Level Classification E-value
Superfamily DPY module 0.0706
Family DPY module 0.004
Further Details:      
 
Domain Number - Region: 192-352
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.073
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number - Region: 2157-2187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0762
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 3843-3874
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0838
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 5102-5133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0838
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 1948-1981
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family EGF-type module 0.047
Further Details:      
 
Domain Number - Region: 4577-4672
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.1
Family Growth factor receptor domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_04895
Sequence length 11402
Comment [mRNA] locus=scaffold189:315563:381816:+ [translate_table: standard]
Sequence
PCSRKDVCGPNAICSCTNHAITCTCPLGFHGNPTPEQGCVRVPNVCQTPQDCPSQHLCVS
GLCQCQCSEQNNCAQGERCKNGICVKICYGDSNCLPGELCIDGACEAGCTSDVGCKRDEV
CINSKCRCSHGFIAGPEHCLDINECDDQPCHPSAECINLHGSYRCTCPSGTAGDPIGLGC
VLPHHCTTHKDCSDTQACVQHNCSDPCSFVDCGLNTICSVLDHAAGCQCQPGYIGDASGC
FKVECLSNSDCPTDKYCNQETNKCSSPCNQVNCGYGNCLAIDHVSVCKCYSGFVLVGDIC
ADVNECLQNPCHSSAICQNAEGSFACVCPHGLVGDPFKTGCKQPGDCFTDSDCPNSAACI
DNRCTNPCDASGICGRNAECLAHDHVPICKCPGQTTGNPATECIHLECNYHSDCSPSDAC
FDHKCVDPCSLSNVCGHGADCSSLNHSAVCTCQPGGTGDPNLGCTPLQYCKSDSQCATGS
VCNGGICTALCGSTRDCIGDQLCINGLCQPTCRSNSSCPEYQYCHNNICVQELRCTSDND
CSYDEKCIKNNIGQAECRRACDVILCGRNAECKADDHAATCSCKHGFFGNAKDDKIGCQP
IECEVNDDCTQEKICDSHRCRIACLAHNPCGVNAICTTEKHVQVCTCQPGYTGEPTHACK
LIDYCANAPCAPGALCENTRGHFKCHCQPGTVGDAYNSGCQPPVECLQDVDCPLTAKCVN
INNVPKCFDTCARIRCGPNADCVASNHAASCQCRADYEGDPNNLSVGCRPRPVVCSSQID
CLVNTYCYEGICRPSCQSDEECNLSDICLNGQCLDPCDVRGTCGINAECKVRSHIKQCSC
PSGFTGNSEVECVRLPVSCLGSGDCNGDNTCRENVCLPICTVDNDCALNEKCIRGNCLLT
CRLDNDCFLGHVCLNNMCSFGCRADEDCNANEACLENKCVNPCEATPCGPNAKCTVFNQR
ATCSCSTGFIPNPTAKVACLRTPGPICQANRDCVVGTACIAGVCTPVCSSSANCLSNERC
DNSGICKSLCRRDEDCRSGEICEGLVCISGCRADIECQDSYECINNQCIDSCSLTSACGV
NAKCTIVNHQKICTCPSPLVGDAHIGCKQTFLPCSSELECLPGQTCYGRSCYSTCRSDAN
CLSDERCDGSICKAICNSDDHCLANQICHNRMCDIGCRSDNTCPSDESCINNQCRNPCDG
GKACGECAGCRVVNHVAQCSCPANYYGNALINCAKTMTPCDGSCECDEIGFCTTNCHHQN
DCSCGEVCHSSKCRIKCDINNACPKGYVCDGGLCLIGCRTHSDCPSSLSCTNGQCENPCS
AQGSPCGINALCRVSSHRAVCLCPEGYQGEPSQECYQLECHHDDDCELNKHCSEYGVCTN
PCLQHGVCGFNAQCRVINRKAQCSCPPGHFGNPKINCKKGNSDRDLGDCRTNGCGKNAEC
IRDGAIFVCRCPPGTSGSPDIECTTDVKCTTHNDCPIQLACVNHQCVNPCTLGNPCDFIE
ACHVQYHRPVCVKVESNETECPYCLPGMQCDPSTNTCIKAGCTSNKDCPLTEACIGHACQ
EPCLVRNPCAEHAVCINTNHKADCSCEEGYHGNGFSYCDLLEEMKNICQYNEDCPPNKYC
DRLNRQCINPCVEFDCGDNAKCVSSNHQAQCTCLPGYQGNPHIGCQEIMLTVDPCVPNPC
GLNALCENDNGNPVCFCPKGLTGSPFEQCIPEGDQCEGNPCGANSGCRVVSGQVKCFCLP
GYEGHPPNFPCTLPSTSCDPSPCGPNTRCSVLDNGFAKCTCLPGYIESPNTIRGCVPKAD
QCEFNPCGFGARCNSTRVPPCYCPDLTIGNPYKSCGVRPEEPYDPCLLSPCGKNAICTAI
DGIAKCTCIPPFVGNPYIDGCEAECIINRDCESHLACFNQHCRDPCPGVCGANAHCEVVD
HLPMCSCLPGYTGDPFRACKVEKPLVPDQNPCMPSPCGPHSICRVMKDRAVCSCSPSYQG
TPPHCRPECLVSTECPAHLACIDQKCNDPCPGLCGLNADCQVINHNPICSCPRQYAGDPF
TQCVKEEPLPPTTNPCLPSPCGPNADCRVQEDHPICTCISGMFGAPPNCRPECVIDQDCI
SSLACIQKKCLDPCVGSCGFNTNCTVLNHRPICHCYEGYEGDPFSGCAKAVFPVQLPCDP
SPCGTNAVCKERNGAGSCTCLPDYTGDPYEGCRPECVQNSDCAHTKACINNKCKDPCVGA
CGINAQCQVYNHQPSCSCLSGYTGDPLTSCHIPIKPSPPVDTCQPSPCGPYSNCRVIDNH
AACSCQPNYIGSPPSCRPECVVSTDCSPNTACINQRCKDPCLGTCGVNADCRVINHNPVC
ICAIGYSGDPFFEVTPLPKPSDNPCVPSPCGPNSQCRVIDGFPACSCLPNYIGRAPNCRP
ECVINEGCPGNLACQNEQCVDPCPGSCGVNTYCNVVKHNPVCICNEGYTGDPFTECIPII
EAPITTEQPRTPCNPSPCGANAVCNERNGVGSCTCLPQYFGDPYIACRPECVTNADCDRS
KACLNNKCVNPCPGTCGQDATCRVINHAPMCSCLPGYTGDPVNGCTIIIVTPLPVPIDPC
DPSPCGPNSNCRTHDGHAVCLCQPGFSGVPPTCRPGCIVSSECPQNRACINNKCADPCPG
SCGQNTNCLTVNHNPICSCASGYSGDPFVHCTRISITSPSPKGEEDPCLPNPCGPNSQCR
VIGSHPACSCLQNYIGRAPNCRPECTDNSECFNTAACINQRCKNPCPGACGEIARCTVQN
HVPICTCPEGYEGDPTVRCVLPSPPATDRTVSNPCSPNPCGPNAQCRERNGAGACGCPPD
LIGDPYDIIKGCHRECETNNDCAPQLACVGFKCTDPCPNTCGTLSICNVQAHVPVCLCPP
GYTGDPYFACEIEEVIKTLEPCSPSPCGPNSKCRVVNDQAVCTCLPEYRGIPPSCRPECI
VNAECPLHLACINKKCVDPCPNICGLKAQCITKNHNPICTCPVGFTGDPFTFCSPHVTTE
LPITERPPSCTPSPCGPNSLCQIISGNPACSCLPNYIGVPPQCRPECILSTECKSHLACV
NQRCADPCPGSCGINAQCHVLNHLPVCTCMEGFTGDPFTQCSIIPPVTESPSMDPCALSP
CGPNAICDNGDCKCLPEYIGNPYEACRPECILNSECARDKTCLKNKCKDPCPGICGQNAQ
CDIVNHIPVCSCPSGYIGDPFVSCRVQPRVPDSRKDPCTPSPCGPNSQCRNIEDQGVCSC
LQGYLGSPPSCRPECLVSSECPPTRACVNKKCTDPCLGSCGLNARCEVINHSPICSCLSG
QTGDPFRSCYDIPLPPEPKDRGDPCSPSPCGPNALCQNANGQPSCSCLPTYIGIPPSCRP
ECLINPDCPPEKSCINMKCKDPCPGSCGDNAECKVVNHAVTCSCKLGYTGNPFVQCVLEE
EPMNPCEPSPCGANAICQQRDNAGACICIDDYQGNPYEGCQPECVLSADCSTNKACVRNK
CKDPCPGVCGVRAQCSVINHIPTCTCEPGYIGDPFMTCTLQPEVDTEPTVRDPCSPSPCG
PNSLCRAVNNQVVCTCQESFVGVPPNCKPECVVNSECPQNRACYKYKCTDPCPGTCGIEA
NCRVINHNPLCSCPQGKTGDPFSRCFPEPVVPLPPMDPCFPNPCGLYAECKIVNNQAACT
CLKNYIGIPPNCRAECVVNTDCPSDQACISEKCRDPCIGSCGQNADCRVQNHIPVCLCQP
GYSGDPFTLCTVIREQPKIPEDLCSPSPCGPNAECNEGVCKCLPNYFGDPYSYCRPECTM
NSDCPRVKTCINQNCVDPCPDTCGRDARCDVVNHVPMCSCPPGYTGNPFLLCQPHIPDDT
IKQPCTPSPCGPNSICKVVNGHAVCSCQPGLIGSPPACKPECIISADCPLTQACLNNKCQ
DPCPGTCGQNTNCQVVNHNPICSCSESYTGDPFTICYPQPKTPPISMNPCLPSPCGPNAE
CQVRGDSPACSCIENYVGLPPNCRPECTINPECPPQLACMQQKCRDPCIGLCGPNAQCSV
VNHHAICACINGYTGNPFSACEQIPEDTPLDIRKPCEPSPCGINAVCRENNGVGSCTCLP
DYLGDPYQECRPECTQNSDCLTRMACVNLKCRDPCPGTCGVNAQCQSVNHLPICICIPGY
TGNPFTLCSPIVEILLPETNPCSPSPCGPNSKCRDINGLAVCTCLPNFIGSSPNCRAECV
MNSQCSQDLACINQKCISPCPDPCGINTQCRVINHSPICICNLGYTGDPFTRCFPAPQSL
DFPVVSKDPCLPSPCGIYAECRNIGSTPSCSCLPTYRGSPPNCRPECRVNSECPMNLACN
NERCRDPCLGSCSITSLCTVYNHIPVCTCSEGFTGDPFTNCYPRPTTAPAVIDPCNLNPC
GPNARCNNGICICLPEYQGDPYVGCRPECVMNTDCAHDRACVRNKCMDPCPGTCGRNALC
SVYNHVPMCTCPTGMAGNAFVQCSIVEDIPKRDSCSPSPCGPNSVCRENNGQPVCSCVVG
FLGVPPACRPECTISSECILTEACSNQKCINPCLGACGIQATCQVINHNPICSCGELTGD
PFIRCIPRPPEPVLQTNPCVPSPCGANAECRVVGDAPSCSCLAEFLGLPPYCRPECISNS
ECPAHLACMNQKCRNPCEGSCGANAECRVVSHTPMCVCPSDFTGDPFTQCTMRPPTPIPL
SPCKPSPCGFNAICKEQFGVGSCSCLPDYVGNPYEGCRPECVVDTDCISILACVQSKCKD
PCPGVCGQFAECQVINHRPSCTCISGYSGNPFQYCNVIRDVVDTPRDVCNPSPCGPNSQC
RVNNNQAVCSCLPIFIGNPPACRPECVTSSDCSLNLACLNQKCQDPCPGSCGRNSNCRVI
KHNPICSCKNGFTGDPFTVCFQTPVSPPVVSDVTRDPCIPSPCGMFSECRDIGGVPSCSC
LPTYRGSPPNCKPECTINAECPANMACMQQRCKDPCPGSCGIMAECSVINHVPICSCLPD
YTGDPFIGCSVKPLIVAPSKPDPCTPSPCGPNTQCNGGICVCIAEYFGDPYSGCRPECVL
NNDCPNTRACVRNKCVDPCPGVCGQNAMCNVYNHVPMCTCPSGMDGNAFVLCSPVPAPPI
SNPCNPSPCGPNSQCRKNNMQAVCSCISGFVGAPPTCRPECVISSDCSKNEACTNQKCQD
PCPGSCGRNTVCNVINHNPICVCRSGMTGDPFINCFPLPEEPLPVLNPCQPSPCGPNAQC
QVINDQPSCSCLQEFIGSPPNCRSECISNSECSNKMACINQKCRDPCINACGINAVCNVV
SHTPMCACTPGYTGDPFTQCSPQQFDIQPSISTPCTPSPCGANAVCRVQQNAGSCSCSTD
YIGNPYEGCRPECTLNSDCPSNQACIGLKCKDPCPGTCGQNAQCYVINHAPTCTCFERYT
GNPFIFCNLIVEAPIIADNVNLCQPSPCGPYSQCRESNGQAVCSCLPTYIGAPPGCRPEC
TVSTDCATNRACENNKCVDPCPNSCGQGTTCRVVNHSPICMCKPGFSGDPFIRCLLVPPT
PSYLPSLPSDPCIPSPCGSNSQCRNVNGYPSCSCMINYIGTPPNCRPECVIPADCPSNQA
CIRERCQDPCPGSCGLNADCTVHNHIPICRCIESYTGDPFIGCQPIPIYNEPTQPIDPCN
KSPCGPNAQCNNGICICLPEYFGDPYVGCRPECVLSTDCSTDKACIRNRCVDPCPGTCGQ
NSLCNVINHTPMCSCPPGTSGNAFISCDVIRVPSVTRPCSPNPCGPNSICRELNEQAVCT
CAPEFLGAPPLCRPECTLSSDCRPNEACANQKCKNPCPGTCGIQARCVVVNHNPVCSCPE
RYTGDPFIRCDIMKPIAPVVINPCQPSPCGPYAQCQVVNDLPSCSCLPEYKGSPPYCRPE
CISNPECPSHQSCVRQKCRDPCPGLCGENAECHVIQHVPHCVCSYGLTGDPYTRCSAIPR
PIELEPVSSPCVNFECGANAICRERDSVAICQCISSYVGNPYLACRPECIINPDCASNLM
CVRNKCANPCAGMCGRNAECSVVNHQPICTCLPGYTGDPFISCSVDKIISDENVCAPSPC
GPNSKCKEVSRQAVCSCLPTYVGTPPACRPECVASSECSPQLVCKDYKCVNPCPSPCGLN
TNCVVVNHSPICSCMSGYSGDPFTICSLIPPITPPLVQKDPCVPSPCGSFSQCRNIGDSP
ACTCLENYIGQPPNCRPECIIHSECPSDKACINMKCVDPCPGSCGTNALCSVINHIPTCR
CPEGYTGNTFVLCEILPAITTPSPIEDACIPSPCGPNAQCFDGICTCLPEFRGDPNVGCR
PECVLNADCPRDRACIHNKCLDPCPGACAVNALCTVIGHIPMCSCPGNMTGNAFSQCTPL
QDISLANPCTPSPCGPNSECRVINNQAVCSCIRGYLGSPPTCRPECIVSTDCPQNEACSN
QKCTNPCPGSCGLGASCQVVNHNPICICPPPQTGDPFVRCYLPPPQIPVLPVTPCKPNPC
GPNSQCQPRGDESVCTCLPDFIDSPPNCRAECVSNSECSNHLACINKKCQDPCISSCGAN
ANCHVVSHTPMCSCINGYTGDPFTQCILREPTPLPPAPIDPCNPSPCGSNAMCKEFNGAG
SCTCLPNYTGNPYEGCRPECVLNSDCPANLACVNMKCRDPCPGSCGRNALCQVVNHLPVC
NCYPKYTGDAFSYCTPIEIEGENAVSNPCEPSPCGPNSLCRVVDNTSVCTCLPDFQWVAS
PPNCRAECTVSAECAFNLACISYKCNDPCRTLCGSNARCETINHNPICSCPPSFTGDPFV
ACFEMPPKDEEPRPLVNPCAPSPCGPYSECRDINGQASCACLSTYVGTPPNCRPECSVNP
ECPTNQACIQRKCRNPCDGVCGVGAICNVIRHTPTCSCSNGFTGDPFVMCKLIPEEDTTL
KPTDPCLNCGANTQCFNGICSCLPEYQGNPNFGCHPECILNSDCPRHRACIKNKCQDPCG
LGICGVNALCSVINHIPVCTCAQRMSGNAFVQCSPIADTIPKDPCNPSPCGPNSQCRKIK
EQAVCSCLPGYLDAPPNCRAECIISSDCLANRACNNQKCIDPCPGTCGIRAQCTVVNHNP
ICSCSSELTGDPFTQCIPRPIESPTPINPCVPSPCGLNSKCEVVNNAYSCSCLPEFIGDP
PNCRPECVSNSECSTQLACINQKCRDPCPGSCGINSDCRVISHTPMCVCLIGFEGDPFVL
CNPKQSDVINAVKPTPCIPSPCGFNAMCRESNGVGSCMCLSDYTGNPYEGCRPECTINSD
CTADRACVGSKCQNPCPGFCGYNAICQVVNHAPLCTCQSGYSGNPFVSCNRIVQDTSLEL
NPCSPSPCGLNSQCRELNGQAVCSCLPTFIGTPPNCRAECTVSSDCPVNRACKNRKCVDP
CPGICGINARCEVINHSPICSCNQGFTGDPFVTCFQTFIDKDIPQTPENPCVPSPCGPFA
TCRDSGYAGVPTCTCMENYIGSPPNCRPECTVDSECNNNQACLRQKCRDPCLGSCGIGAQ
CLVVNHMAVCLCPKGYTGDAFANCFPEPAPASIPQDPCNPSPCGANAVCRDGVCTCMPEF
HGDPYTACRPECVQNPDCPLDKACVRNKCFDPCIGVCGQNAKCTVINHTPMCACPDGMSG
NAFAVCYPVIQDQTVIENPCNPSPCGPNSRCQNFNNQAVCTCIIGFIGNPPACRPECIVN
TDCALNEACINMKCGNPCLGACGISARCQVLNHNPVCTCPPVFTGDPFIRCVPRPEDIPK
PINPCQPSPCGPNSQCQVINDTPSCSCTIEFIGTPPNCRPECISNSECPSQMACINRKCR
DPCPGSCHSLANCYVVNHVPTCTCRVGYTGDPFVQCTIMPSEPPALRQPCQPSPCGTNAI
CREQNGVGSCTCLLEYIGNPYEGCRPECTISSDCPAHLACIGSKCQNPCPGSCGTNTNCQ
VVNNIPICTCIPGYTGNPYINCIYQTLSIPDEKREPCKPSPCGPNSQCTNNNGQAVCSCL
PQFIGTPPNCRPECLVNSECGSNRACVNQKCVDPCIGTCGRDAQCKVVHHSPICVCANGY
TGDPFIYCFAVAISKPEDQYLKDPCLPSPCGPNALCRAIGDAPACSCMQNYMGVPPNCRP
ECSINSDCPANRACIREKCRDPCPGSCGLLARCSVINHTPSCICPEGYTGDPFISCNVLP
QIPLLPPDRCNPSPCGQNAQCNNGVCTCIPEYLGDPYVGCRPECVINTDCPRDKACMLHK
CRNPCIGTCGVNAECIVVNHLPMCSCPRNMTGSAFVSCTPLQDSTIMEQPCNPSPCGPNS
HCRVSNNQAICACIAGFRGAPPSCRPECLISADCARNRACSNQKCIDPCLGACGLTAQCT
VVNHNPICSCPPLYTGDPFVQCIRQPEEPQPPVDPCQPSPCGPNAVCRVLNGAPSCSCLP
QFIGTPPRCRPECVSNSECPSQQACINQKCRDPCPGSCGRNAECRTVSHTPMCICAGDFT
GDPFIQCNPRPIDTPLVPLNPCQPSPCGANAMCREISGSASCTCLPDFYGNPYEGCRPEC
VINSDCTSNRACIRNRCQDPCPGTCGVNAICEVINHIPACSCQSRYTGDPFRYCEPIQET
PPVPIGDPCQLSPCGTNSRCLNVNGKASCSCLPTYQGIPPDCKPECIVSTECPINRACVN
QKCVDPCPGVCGINAKCDALSHSPFCSCGPNQIGDPFVKCFDMPLMPVQTLQINPCVPSP
CGPFSTCQDRGGYPSCTCMPNYIGSPPYCRTECSINSDCTSNKACIREKCRDPCPGSCGF
NALCTVIKHTPTCTCLDGYTGDPFSNCYLAPMQIPTVTSDPCNPSPCGLNADCRNGICNC
IPEYRGDPYRECRPECVQNSDCPFNRACANNKCVDPCVGICGQNAECAVINHVSTCSCVK
DYEGDPFTLCKRVQSRVKPCEPSPCGPNSVCREFGDQASCSCLPGYFGIPPSCRPECLVS
TDCEQSKACVNMKCRNPCENACGQNALCVVRNHNPICRCPVQQSGDPFINCFPITTPDVE
PTRDPCYPSPCGLNSQCAVSVDNIPSCSCSPTFIGSPPNCRPECHVNSECPTNQACIKQK
CTDPCVGLCGFNALCQVTLHQARCTCPESYTGDPFTVCSEIISIPTPPTVPSRPCSPSPC
GINAYCHERFDTAICECVPNYRGNPYQGCQPECLVNTDCPKSQACIKTKCQDPCPGTCGV
GATCTVSNHVPICSCPLPTIGDAFTLCQVPVEDTKETDPCYPSPCGPNTVCEKIGNTAIC
KCLPGLQGVPTSVTGCHPECVLSSDCSGDKACIQSKCKDPCSQNVCGSKAVCKTINHSPL
CSCPSPLIGNPFEECYTKIETNPCSPSPCNYNGECRVRNGVAVCIYPECVINSDCPRDKA
CFSQKCKDPCIGACGINSICQTVNHKPICSCPIGFMGNARVQCTIPALTSEEYINTMLDI
FENRFVKLLLIKKINSIYVMHINFINIFFTVGCRSDSECSLIQSCINNECIDTCLVTQCG
INAMCTADGYHKTRCYCPDGYTGNPYEICERPECTSDNDCAPSLACRNLRCVNPCNCPPP
ALCNVVNHRPVCKCPPGYVGNPYTSCLMDLLEPKTECQVDADCPSKLACFNGICKDPCTE
TKPCIVNAKCSIVDTLPMRTMICECLPNFAGDATVACVPVDKQIAAVCESDSQCTPDMAC
LNRRCINPCTVNPCSPNAECHIENHRRMCQCPHGYVGDPFINCYEENIVLAECRINTECP
SDKACINQLCQDPCSSNRCGLNAECITINHHPSCHCQHGLAGDPQAQCFRPECKTDNDCP
YDKTCRNDNCVSPCLIGDIVCGRNAECRAVSHRAQCICPQGTQGDPRVACISAICHYNED
CADHEACDRLNRICRPVCNDDACGETAICVARNHQPKCTCPLGTTGNPYVTCIGEPSIEP
ECTQDNECALNLACINNKCQDPCISAGMCTSEQVCKVLNTEPLRTMICLCPPNTITDVNG
QCKQIVLGDVQCHLDQDCANYETCLDGKCVDACLTTQCGFNAQCKSTSHTGICFCSQDFT
GNAYIECIRVPVVPLPGPRPECYTNSECARDKQCINSLCVNPCVASDPCGKSSLCHVDNH
NPICKCPIGYIGDPKTKCIPPEITPECVSNSECAGNYACVNDMCINPCNCGPNAKCNVIN
HYPSCVCPPGYSGNPQLGCFKLDCESDSECDYAATCYNGQCVNPCILDNKCAINAECYGK
NHRSACRCGPGYYGNPQTHCERVECNTDHDCPHNLACNDGRCINPCAENSLCAQNAVCYV
QDHIASCRCPENIPLGNPFSYCERHTAVEIEEPECKVDIDCLDKLVCIREKCIDPCPVIK
PCLENARCDVLDTVPVRTMICTCPEGWITDIDGVCRPIQLTVIGTCTTNDDCSDRETCIN
RQCRNPCNCGTNAACYVKNHKPICSCEQGYQGNPEIACHSVECQHDSQCTLDKTCKNNNC
VNPCLVTDLCGTNAECFPNNHVADCRCRKGYHGNPLDRCRVIGCFSNGDCPGDHSCINMQ
CIDPCIHDNPCSPRAECKVLNHLPICRCPSGFTGNPYINCQPEVRPECREDSDCPDSLAC
LNNKCQIPCPIIQPCTEPSECRVLPTHPIRTMVCVCPSGYVSSGSGTCQATTPILKIECT
KDDDCPSERSCVNAICKDPCACGPNAVCNVINHKPICSCTLGYDGNPDILCTRVAGCKTD
NDCSGSHVCVQRNCVPACSPSLTSCGKNAVCHGIHHKAICECPPGFGGNPRVSCVLLGCR
TNSDCPTNKACINNRCENPCVQNPCTGNMDCNVYNHIVECVCPSGYIGDIKSGCTKVKEK
CKADNECPSQTACFNGQCINPCTKIAPCGINAECKVLDTSPIRTMICECLPGYRGNAIIR
CDQIPAEICPIGKGQIRDEYGNCICPPGFGKDANDVCIPCRKQSNMVINEEGYCVCDLEK
GFSIDEYGRCVCPTRYGYEIDTKGYCRQIGVIECRHNDDCADDRYCDKVTHTCQDPCKKQ
QCGVHALCNATRHQAICICVNGYLGNPYTQCYDRKDGRTDFPRPEMDVSCLSDGVQVVIH
LQDQDFDGVLYVKGRSKDEQCRRVVSIPAETDHKTETFKVAFGNCGLIHVNGQASFVLVI
QKHPKLMTYKAQAYHIKCIYQTGEQNVTLGFNVSMLTTAGTIANTGPPPICVMKIVAQNG
NEINSAEIGDNLMLQVEVQPSTIYGGFARNCVAKTMEDNLENEYIVTDENGCATDPTIFG
EWEQNPDTQSLMASFNAFKFPSSDNIRFQCNIRVCFGRCQPVNCRGYNAFGRRRRDVDSE
INDTSLSVSDGYEGQLREEITIQSNLIFTLERREERYTADPAEAPSAQRVEDICVSMVGF
IIALIITALLALVAVAIAVSCWLMAYRRQPKTAGPLPHPPEFPNPLFTTESVAEPSPDYH
LS
Download sequence
Identical sequences F4WBN7
Aech_04895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]