SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_05068 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_05068
Domain Number 1 Region: 78-290
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-26
Family YWTD domain 0.00042
Further Details:      
 
Domain Number 2 Region: 395-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000089
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  Aech_05068
Domain Number - Region: 364-393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00754
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_05068
Sequence length 616
Comment [mRNA] locus=scaffold511:792514:803743:- [translate_table: standard]
Sequence
MLLVTPRSVHANAEQLPVMISAKTRSFLLSTLCLLCNLVVTTYARSWDLAVVIGNEIDFY
ARNSTRMGHASIKEAIALTGVTYDDTTRTMYLSDVKNNVSIFSNDLTERNFTSTPLLKKE
NGMHVVDIVFDTPSRTLFWVDALKEIIAKMHVSENGEPGVPVVLHNLTGSSPRGIALDVC
NSRIYWPNSNSSNPSIECSNLDGSNRMIVIKENLYEPLAVAIDHAEQKLYWIDDVEGIHF
KIERSNLDGSQRELLVHKQNQQPVYLAVDNELIYWSDWVYRAIWTIPKNTKAGDSPSKFK
SYFSKRDADPAGIVTRDNIGQIDCVKILSKEKKPNLLVPASRPASETFNNLTTSTEESDL
TTESSKYCLNGHLNKTTNICRCKEGFTGSFCEKSLCHNYCLHGKCTINHRGLPECICTDT
FSGDRCEINVCNGYCLYDGECSVQDGKPFCSCKYSKGTRCEESNDIEKICAIYCASDHVG
LPNISVTSCRCTNFNQTAERITLTKSFQNGILLPIFIAFTILFLLMIAVLSYYINKLRRR
PRIKRHYVVSKGVTPLTSRPQIPDNQCEITIENCCNMNICETPCFEPKLRNGVSKSNNVK
KEEKNFLLDDMEGNSC
Download sequence
Identical sequences F4WX01
Aech_05068 XP_011061340.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]