SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_05158 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_05158
Domain Number 1 Region: 22-427
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.8e-70
Family L-arabinose binding protein-like 0.0024
Further Details:      
 
Domain Number 2 Region: 713-903
Classification Level Classification E-value
Superfamily Nucleotide cyclase 3.14e-63
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000247
Further Details:      
 
Domain Number 3 Region: 432-693
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.45e-41
Family Protein kinases, catalytic subunit 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_05158
Sequence length 1109
Comment [mRNA] locus=scaffold315:332870:348524:+ [translate_table: standard]
Sequence
MYLFLMVIHVLLINKGVDAETFTLGYITGSKRRDNDLEYQRPGLRISGALTLAVEEVNAG
ELNRRGHKLDFFVAETYGNEEMSILMTADLWKKNVSAYIGPQETCIHEAKMAAAFNILMI
SYFCTHNETSNKKEFPTFARTRPPDSQIAKSVVSVLMAFNWTKVTFLYMNSTMFEFNKMS
TVATTILMSFEAAGIAVNYCLSWNEPYHVTHMKNPFHELVRQTYRGTRIYLILGHYYEHI
GLLMALDKMNLLEKGEYFVVGIDIEFYDEKHPNKYLKGLLQKNMDFSIIRAYRSYFSIVA
SAPINYMNFTRLVNKYRQKPPFNFTNPSANVGGIVQIVPETAYLYDAVHLYERSLLRALK
NNINPWNGKEMLSTLRGIHYQSAMGYMVYMDENGDAEGNYTLIALDNRPVKGYGLYPIGY
FIGKEQGTNLPMRDIRHDNLNSFIGACIEPPNICVIVEYCARGSLKDILENEDLHLDNMV
ISSLVGDIIRGMIYLHESVIKYHGSLSPSNCLVDSRWVVKLTDFGLNEFKRNEECDSNVI
KTLHGLLYKAPELLRCTSPWELNVRDLQRGDVYSFAIVLYELQGRHGPFGITDLSADKIL
KRIENPYYEVSPFRPPLDQLDNTFDFIRKCLLECWSENPELRPDFKMIRYKLRPLRNGMK
ANIFDNMMAMMEKYANNLEALVDERTDQLTKEKKKTDALLYEILPRYVAEQLKMGHKVEA
ESFDCVTIYFSDIVGFTSMSAESTPLEIVDFLNDLYTCFDSTIENYDVYKVETIGDAYMV
VSGLPIRNDIQHASEIASMSLCLLNAIKQFTIRHRPFDKLQLRIGIHSGPVCAGVVGLKM
PRYCLFGDTVNTASRMESTGLPLKIQCSCETKQLLDQLGGFNLIERGVISMKGKGDRLTY
WLIGEDPLLCSKRSKERASKQSGKKINVANALVPRSSLKNKSLVRTTFTRCSSDSPKRLR
FTSSDQLNQKDSRVSQSESIADNSKTKISCVLQSSRMENWQSSSNSCPCVKKLYDQETQE
LINESSSTIKNVSLLRARLIHNNNSLICSEAKSFRFNSPDILLTCKSVPNSPKYSKGYLS
IQKRVVKSYEKINERDVTPLIYDPGGSEI
Download sequence
Identical sequences F4WKQ1
Aech_05158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]