SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_06635 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_06635
Domain Number 1 Region: 906-1040
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.75e-19
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 600-745
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.63e-18
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 1731-1862
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.1e-18
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 417-546
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 2091-2222
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.18e-17
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 295-428
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.21e-17
Family Growth factor receptor domain 0.0068
Further Details:      
 
Domain Number 7 Region: 2330-2455
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 842-909
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.88e-17
Family TB module/8-cys domain 0.00059
Further Details:      
 
Domain Number 9 Region: 1819-1952
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.06e-17
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 10 Region: 1942-2006
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.12e-16
Family TB module/8-cys domain 0.00043
Further Details:      
 
Domain Number 11 Region: 1412-1484
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.62e-16
Family TB module/8-cys domain 0.00027
Further Details:      
 
Domain Number 12 Region: 1001-1133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.98e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 13 Region: 2215-2277
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.01e-16
Family TB module/8-cys domain 0.00078
Further Details:      
 
Domain Number 14 Region: 1572-1640
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000249
Family TB module/8-cys domain 0.00096
Further Details:      
 
Domain Number 15 Region: 538-614
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000288
Family TB module/8-cys domain 0.00055
Further Details:      
 
Domain Number 16 Region: 226-292
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000471
Family TB module/8-cys domain 0.00089
Further Details:      
 
Domain Number 17 Region: 81-164
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000334
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 18 Region: 734-789
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000034
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 19 Region: 1205-1322
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000102
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 20 Region: 1496-1546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000312
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 21 Region: 2291-2340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000121
Family EGF-type module 0.007
Further Details:      
 
Domain Number 22 Region: 796-846
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000133
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 23 Region: 1119-1175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000397
Family EGF-type module 0.013
Further Details:      
 
Domain Number 24 Region: 1330-1416,1518-1576
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000463
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 25 Region: 2011-2065
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000767
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 26 Region: 1647-1702
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000183
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 27 Region: 183-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000907
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 28 Region: 2455-2571
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000108
Family Growth factor receptor domain 0.0097
Further Details:      
 
Domain Number 29 Region: 1164-1199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000033
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 30 Region: 1693-1734
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000664
Family EGF-type module 0.0084
Further Details:      
 
Weak hits

Sequence:  Aech_06635
Domain Number - Region: 22-81,131-188
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000115
Family Growth factor receptor domain 0.0054
Further Details:      
 
Domain Number - Region: 2054-2089
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000175
Family EGF-type module 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_06635
Sequence length 2757
Comment [mRNA] locus=scaffold67:753394:772707:- [translate_table: standard]
Sequence
MSSTVITAETGNGGDRGDAGRCKVHCINGNCVDGRCQCRSGYQGEFCNEPICREPCLNQG
RCIGPDRCACIYGYTGRRCETDYRTGPCFTKVKNGQCLASLQGVVCTRQLCCATVGKGWG
HPCERCPARLDCELGYLKTNQGQCVDINECEAIPGLCEGGKCLNTPGSFTCECPTGQARD
PETNECKDRDECQEEDICADGRCINTNGGYYCHCNPGFIQSQDRKFCIDGRQGLCYTAVN
RNGQCRNRLAMRLSKKDCCCGKNMGRGWGDECFICPNPGSDDYNRLCSQLQSITEVNECV
LRPDICGDGKCIDTKEGYECECYPGFTRKPGGRCEDVDECQLDYCQGGICRNYPGSFACD
CPPGFVVSGEGRYCTDHDECQDTGMCTNGHCINMNGSFKCKCNDGYALSPTKNTCIDINE
CIENPRICLNGHCENTPGSYHCICQSGFTPSRDNTFCVDMDECSTSGMCENGKCVNMEGS
FKCVCDSGFRIGPDLSHCIDIDECVNLPCQNGRCINTPGSFRCECHPGFNLGPDGRSCLD
TRRDLCYSQYRDGQCSNPTSTAVTKSSCCCCTVILGQPMGWGSTCQPCPLPDTTEFEALC
PHGAGMTYNGDDINECAQNPNICVNGGCENLMGTYRCICDNGYEVDATGKICSDINECEL
EDSLCSGGQCRNTPGSFQCICPTGMRYNTQNQMCEDVDECEELGPDVCFNGVCINTPGAY
ECECSPGYILDNTGHICMDNRKGSCWTKMINGRCENNLPKITLRSECCCSVGVAWGSPCE
ICDHSLCECSKGYAKVDGKGCADINECELNSGICKGGGTCVNTDGSYRCECPPGLTLDTT
HTTCMDTRQEICFLDHRHGQCTSPIEGHFSKSLCCCSVGRAWGSDKCELCPKIGTHAHTE
LCPRGDGFTERQDINECVEFPGMCLNGRCKNTIGSYSCKCNQGFALDEHGIKCNDIDECE
IMRGVCGNGTCRNTPGNFQCDCNPGYRSNDIMKICMDIDECEETSGLCRGGICINTEGSF
NCQCPPGHELGPDKQSCKDIDECSRTSGICSNGVCENMMGTYQCICDDGYQQTGLRSHCE
DINECAIGNGGCEDICLNTPGSFSCSCRIGYALNLDGRTCVDVDECKENPRICNGGKCQN
IPGGYICNCTNGLLPGRDGISCIDVDECVTQPQICGYGECYNTIGSFNCRCEEGYSVKPA
EGPACTDDDECRLNAYSCSEFADCQNTQGSYMCTCHEGFTGNGIECWDINECSTNNGGCD
SNAHCINTEGSFKCVCDAGFRGDGYNCKDIDECTEDSTLCENGHCLNYPGAYRCECEMGF
MHPDERNEQACVDINECEMFSNLCVFGRCENIFGMFRCECNEGYKLDGSGGNCTDVDECE
SPQSCQYGTCINTQGKYICRCPPHHELVEAGNACVDRRESFCFTGYEHGTGRPQCIFDVS
SSVTKATCCCSIGTAWGNNCEECPQIGTKEYDQLCPSGPGYRPNRVTVILEDINECEEHE
NICQNGHCTNTFGSFMCSCNEGFILDDSKTSCIDINECALHPRICGVGYCINDQGKYHCE
CPEGYMAMPGGKECVDMRKEACYLTYDSGQCLNPMVQPQTKMLCCCSMGAAWGSLCEKCP
GERTREHEILCGLVPGQIMNPITNHSEEIDECALMPTMCTHGNCMNTPGSFECQCNRGYI
YDQDSHQCIDENECQQVPNPCSGNAQCINQQGYFECVCPAGYKLGPSQHDCVDIDECYER
SGICSNGACSNLQGGFQCICHSGFSLTRDRDNCVDIDECQRNPNICNNGTCINTLGSYKC
QCYQGFKLSPNNDCADINECRIMPFLCRNGRCRNTIGSFVCECADGYVLAQDGQHCRDID
ECHEIPGLCPSPGKCQNLMGSYICTCPLGYELDHSRRKCVDIDECIETRDICENGQCINT
EGGVICECPVGYRLSERPNSLKCIDVREEQCYDNYRRGQCTFPREGGMTKKHCCCTMGKA
WGRYCEQCPPENSEEFKKMCPEGAGRDDTGIDLNECLFMTNVCPGGECINTDGSFRCECP
TGYILDETGRRCVDNNECLTVQNICGNGTCRNIDGGFECSCNDGYAPGAHQVCEDVNECL
ELGNQCAFRCHNAPGSFRCICPYGYTLAPDGRHCVDVDECATPANDCRFQCKNLIGTFMC
ICPPGYQKIGMADECKDVNECATNSGLCQHGRCVNLEGSYQCLCYDGFEQSTDGKSCIDR
RVGYCFLQTIGGRCTARTSELRTVTKADCCCTMGAAWGPHCEICPSRDSDNYNELCLDKG
FSVDGQDIDECKTIPDLCRNGLCINTLGSYRCICNKGYKADKSGIQCIDINECELTPKPC
KYNCQNTEGSFICSCPSGFILNPDGISCRDLDECTTGNHLCQQNCINTPGSYTCDCQEGY
IQQGDACHDINECDQPGVCPKPGKCINTLGSFQCICPRGFKLDHTGRFCTDYNECADDAN
CEHGCQNLMGTYRCGCPDGFVQHIYHNQCIDENECNASPCGDNTCINTIGSYKCGCPDGY
QFDNNLAICVQVSAGCLGSPCAFGCTPNGIHGFICGCPTGYQRIGQGHCLSTINPSHQGR
YDEDIGNVPTFQINPDPYHIPPADDKTISTEGCFSCKVNGKERYRRGARNKLIDGRIRTN
GGKIKKKHRNARSKRHHHGTEHVLKINLRQTRHRMRIIKLQSAIEDEDVDYTIVRGNNNG
HFEIVKERGVSALHFRHRLKNPGDFRLVIHGRPENTTATRTEWEKPLTFMIRLIVTE
Download sequence
Identical sequences F4X2Q6
Aech_06635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]