SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_06740 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_06740
Domain Number 1 Region: 14-51
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_06740
Sequence length 149
Comment [mRNA] locus=scaffold110:625054:626114:+ [translate_table: standard]
Sequence
MHWLVCTCILTATTVLSCRQSEFQCANGHCVALNKVCNVVDDCGDGSDETRPCSLCAKAS
GRITNQMSSSQLPVFWSQFLLPGCSRTVIDPFIVLWQVASISASIPASKRALLRLPAKPG
VRRNFYFVRNADLSAFFPAQTSRCLGTAS
Download sequence
Identical sequences F4W514
Aech_06740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]