SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_06890 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_06890
Domain Number 1 Region: 1562-1672
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-36
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 2 Region: 1099-1208
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-36
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 3 Region: 746-858
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-34
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 4 Region: 1214-1324
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-33
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 5 Region: 980-1093
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-32
Family Spermadhesin, CUB domain 0.00074
Further Details:      
 
Domain Number 6 Region: 1805-1913
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.15e-31
Family Spermadhesin, CUB domain 0.00036
Further Details:      
 
Domain Number 7 Region: 865-976
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-31
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 8 Region: 1445-1558
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.16e-31
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 9 Region: 1326-1443
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-30
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 10 Region: 2881-3000
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-30
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 11 Region: 516-630
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-29
Family Spermadhesin, CUB domain 0.00064
Further Details:      
 
Domain Number 12 Region: 2409-2525
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-27
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 13 Region: 635-741
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-26
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 14 Region: 3617-3729
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-25
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 15 Region: 2303-2403
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-25
Family Spermadhesin, CUB domain 0.0009
Further Details:      
 
Domain Number 16 Region: 2045-2162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-23
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 17 Region: 1919-2025
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-22
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 18 Region: 3002-3114
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-19
Family Spermadhesin, CUB domain 0.00036
Further Details:      
 
Domain Number 19 Region: 3117-3228
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-19
Family Spermadhesin, CUB domain 0.00079
Further Details:      
 
Domain Number 20 Region: 3236-3352
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-19
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 21 Region: 3505-3612
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-17
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 22 Region: 2530-2641
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-17
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 23 Region: 2765-2874
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-17
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 24 Region: 3372-3431,3459-3505
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-16
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 25 Region: 2163-2290
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000144
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 26 Region: 1675-1798
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000379
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 27 Region: 167-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000882
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 28 Region: 475-516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000639
Family EGF-type module 0.013
Further Details:      
 
Domain Number 29 Region: 336-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000648
Family EGF-type module 0.017
Further Details:      
 
Domain Number 30 Region: 216-253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000144
Family EGF-type module 0.01
Further Details:      
 
Domain Number 31 Region: 438-476
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000587
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  Aech_06890
Domain Number - Region: 295-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000293
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 386-423
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000695
Family Merozoite surface protein 1 (MSP-1) 0.055
Further Details:      
 
Domain Number - Region: 2644-2766
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00119
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_06890
Sequence length 3742
Comment [mRNA] locus=scaffold527:415442:436316:+ [translate_table: standard]
Sequence
MALASMWFLLLYLYLCDAWMDERPVLESRDGHLIISSAKDRNITLKMIGDGYMNVNEINL
LHVASAAQNATRVIDRWRMGYLAEMENSLHQLTTIVTGTTGLQRRVALLERSIDMNNTIR
TENRSRIYIPNFNSLALARSSSIRRINVRLKALEDSLRAMQTLLRENECQSNPCQNGGTC
EDLYDAYQCHCPSNWEGPNCMTDVNECARFLGTDLGCQNGATCRNLPGSYRCDCLPGWFG
LHCTQKTSICNTENSEALCGEHGVCVGKSGSSLGYICICDQGWESDGTSPACTKDVDECA
AAHPPCSVNPPVPCRNTRGSFTCGACPHGYSGNGYYCTDIDECLINNGGCSTSPYVQCIN
TMGSRTCGACPPGYRGDGVSCIFVGGCAINNGGCHPLATCTENPSLTSSYVLCRCPPDYV
GNGMGPNGCQLADVSLNTACSSNPCVHGTCVPNGANGFTCRCNSGYSGLTCSIPIDLCTP
NPCRNSGICTVLNGQATCQCTTSFTGNRCETPRQACGGVLRNPMGTLQFPMGGSTYQHGL
SCAWVLITEPSKVLNVTFTSFNLEQSTDCKFDFLQIHDGRNAGSQMINRFCGHTLPNENG
TIISSHNTLYLWFHSDNSISHNGFTFRWKSIEPICGGVLENNYGTITSPGSPGRYPPNRD
CFWSIIVAASKRIQFHFGQLMLEQNCNDYVEITGAEEERLELFCNHTRPSPLITPSSEAM
VHFHSDGFNQDAGFQIHYSIIEGIPGCGGIFTSATGLINSPGHSSLYQPNMECEWKIQLP
AGERIRASWLRFDLETSSSCQFDFVEIYDGPNMLSQLLGRYCGSDLPPAIKSNSNSLVVV
FKSDWSYEGEGFTLSYETLCGGEFHADTGIIKSPFYPNPYHHSRTCIYEIIQPSDKGIVL
TVEDMDIEGRDQNCYYDYVEIFDGDNENATQLATLCGDEENMPNTPYYSTHNFMYIKFST
DSNINGRGFKLNYTTINRRCGGLLKEPNGVIQPPHQNGSYFDNEECIWTIQAPPGYIIQL
NWMSFNLEYHNDCVNDYVKIYENYTSRDENIIATYCGSTKPPEITSQDHTLTILFHTDIT
ITNEGFVASYIFMDTSKVCGGHYSKSNGIIRSPNYPDYYPNKKDCVWIIEAQNRHRIILT
INHFELERQSSCSFDYLEIRNGGYDSAPLIGKFCGTDIPTEIPSQANQMYIRFVSDFSRS
MAGFEIQWDSTTQGCGSSITAVTGDIISPNYPEPYTMNADCYWKIAVAAGSLVQIIIVDL
DLEHHQKCRYDFIEIYEGINHLTNGRRYCGITYPKLIQSKSNQMTIRFRSDYSNAGRGFH
LKYETQCQNKLRGYYGVIESPNFPNKYEHSTNCSWIIEAPIGNTINLTFSHFDLEGKIEQ
SQCIYDYLQIMEGDDDIPNNMLGLFCGTIDLPMKINSIQHQVFVTFVTDSFIAYNGFRLE
WKVHGCGGHLTKPYDSFTSPGYPSAYPMNVDCEWLIEVDYMLSIELTFYEVNTEKRKGCY
FDKVQIYEGEDADAPKLTELCYSEKPVIYTSHGNKMFVKFHSDSSYASRGFNASYRTVPI
ICGGKFTTISGIIHSANYPQNYPHIVNCEWLLEVDNNHLVNLTFLDFDVENSKNCSDDFV
KIFDGSTKNDPLLGTHCGNQLPPVYVSSSNQMLVVMQSDSIISAKGFKAQYSRACGARII
VKDHGFLTPATGNSDIHDENTNCTWTLIAENPGDHVTITFTHMEMDPTDALTRYESQYHD
SSPCFWLSLQVYEGESTDGPSLGKWCNNVAPPPITSTGNSLTLRTVFYEFIGHFVAMYSV
LNTACGGNYTSQQGIITSPSYPNSYPLNAECVWILNTSPGNRITLMFSEFDIESSENCDL
DYVEVREDSGIGKLISVSCGKDAAEITSSSKLWIKFKSDDSGTAKGFKAEYNIIGGNELE
GPTGRITSPLYPLPYRQPAAFSWRITVEMDWLVRLVFTDLHIENVGQYCFSHINIYDGYD
NEAPLLFKMCGYTLPEPIDSSSNVIYITMTSEFVRLGHWFDLTWLQIIRNSSEQTTNKEI
RLSECNKEIALMGDRNSTYSFSSPGWPTGYAANLHCNWVFTSPPGTHLVLRIMTMDLEET
SNCEADSVSVYSGNALTSTTDAHLESKLCLANSSASLISGSNVMTVKFESDVFDNKTGFS
AYVYRDCGGQLSGRPNGVIQYDNSSFVRSIRTWHFTCEWTVTVKPGRTIKVQIEEMSIQE
MPDHTCSDNYLLLKNGEGMLSPLLGTGKYCGKVLPAELETTGNRFYIKATGVGLNFGFKL
TYREVSMSCGGDFILSNKQKKWEITSPNYPNIPPTYSECIWKATAPAGERLTIHFLDRFD
LSQSENCEREYVEVRDGGTDGSQLMGTFCKDVAPSSMSTNGNMIYVHFYTDVPEPKNGFK
AVITLGEVCGGILRATKGTIKSPNYPHSYPTNINCTWLIVAPTDHNLKLEFRDIQLPGLR
QCRLTDHVKIGEKLVENNTTSIIGSYCGLHKPDVIESSSNEVYVYFQSNNLAFVSYKGFN
LNFTASQETCGGSITALNGIIKSPGYPNPRTKSRYCDWRITLPMDYQVVVNIMDIDVVND
PGPSHVGYALTFYNDFRFKSRIRILGQGRTNIEEIRSSSNTMIISYWSSAGHRGFKLRYR
AEAPAPCGGSLRAIEGNITGPTSPPFNQSSYVCNWKLEPPENMISSVGDSRLTLTIKVTG
ILGGPEHSQIIRRSCIYPQYIEIHGIGIICGNITEPRYLRSPKLINELTIMNGTYGKRMD
FNLQYQWQPCGGVLRESRYTVRSPTNISYPINCVWHVDYPEGETIKLSFKKLELESNCNR
NYLIIKNGGATAPQIAKYCLHTTSELQKYNINSISNQLWIEYFASEGTGSFEFDVMVAST
GCGGALRGRSREIASPEFPKQYPNNGECTWEIIGENGYHLGLTFVDRFSLETSPNCEKDY
VQIFDWIGEEGNYNNGEWKSLGKVCGRNTPAPFNSTSNRMKVIFHSNEAIQSDGFHAIWS
ENCGGVFEATEKVNIIQSPSYPNFYPSSIVCNYTIVAPNDDIVIEFTDFQLERARGDCRF
DNVTTISESMYMAEEVETYCGNSKPPLLRSMSRIEIIFMTDKYVQRSGFQFKYFLNRCGG
IITKPTELKPLMHGEEYFGRMNCTWVIKAPQGKSVLVRFEKFILEFSTNCYFDNVAVYEG
DFVNPDKRTALVCGNLTDNLPTFKSESNSMVVNFNADSSRHFEGFTAKVLFTTSPASGCG
GLINLTSIQSESFRTQQEATYQPFEECHWTVVTSSAKSILFTINSIDIKNSINNITQRDK
CSGDYLEVRDGGGPYADLIGQFCGNSVPSPMISTSNKLWIRFYTDGVTEGAGAIATLNIV
DSLCSLSTRLVNETIHVLTSPDYPNTHLSGTLCRWTLQFADRYSDRMRIRFIDFDLADSN
KCEDEYLEITEEKKYINEGFGTNFIYSGERSHPITVEMGSRLPFASYRYCGSELPHDYYS
YSDKVKITFRSMSNNHKGFKLEYSTANCDRNYTSEQGRILHNGFTSCWITITVPANRTIS
LYFNHFSIYDLEQCTRNALQVREGDSSGPLITTLCSTAMPSPIFSSGNKLTLHSWTESAS
SYQSYDIIYTTTDAGRGCGGRIFNYGGRFTSPLYPRTYRNNTVCTWDVSVPQGFKIILQF
LVFDIGTKKNCSNNNLKVYDVVPSGELLHSTYCGGDDPARLEADTNRVLVKYTSTVNNIG
SGWVIVFMAQSTVHPIDVIENL
Download sequence
Identical sequences F4WY11
Aech_06890 XP_011061859.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]