SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_07269 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_07269
Domain Number 1 Region: 693-738
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000774
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 787-840
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family EGF-type module 0.019
Further Details:      
 
Domain Number 3 Region: 612-649
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000164
Family EGF-type module 0.019
Further Details:      
 
Domain Number 4 Region: 837-901
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000208
Family Complement control module/SCR domain 0.0044
Further Details:      
 
Domain Number 5 Region: 567-601
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000848
Family Complement control module/SCR domain 0.0042
Further Details:      
 
Weak hits

Sequence:  Aech_07269
Domain Number - Region: 634-685
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000205
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 741-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00754
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_07269
Sequence length 1076
Comment [mRNA] locus=scaffold367:211514:236405:+ [translate_table: standard]
Sequence
EREREREREREERGSAFRNSKSKEKHSEPRERPRDTVQVFGCRCERRHVMCIEKRASHAR
LACAVLFLVAITLPFGLCQNARGTSGDRMASNRSGDGSHTLGIRRQYSGDASFEGMETLK
ENRRTLSSRGVIKEPEKTEAEAKAEARGDERGDKHLLLSENGAKILPRRNVNVTTLSKQQ
EGNFGSRTRKKRRRGKEESGGSDVKDRLHEITEDSRENEIMGKRDRSPRKRSDPFSKLRP
KNREARKSRAERRRRKKDRKERNRGSGKDTRRNDRRQDVARRKRKRKTHDGGLSGRVLDK
LDLAGTNTSETTIENSSSFTPDRASLTEAIVTTTSSSLQRHPTLETTRRLTRTTPRRGVY
AADTVEREFSKQLEMEISKSALKDSSILDDGIFDTPPKKSTVRNAAAKEVNGKSVNQDAV
ASLEGKIDFKSSHYDAERMLGYSRTEEDLPILDLENEVLERTLKDYNAYMTSRLKPLSLP
RYDELPIRRNSGTHPPRKPIINSEESVEEIGDGNTEVTDVTGAMQDDSSMKGDLTCINGT
FLPAPLSRHALIKYVKSSTPGHEYLEADYECVPGYGMVSSASRLVCRNRQWVGQVPKCEI
KQNPNRMCAEVSCEHVCNEINGRPVCSCYEGFRLDGRKCVDINECLLNNGHGPCQDTCRN
LMGGYECSCENLQDASLTADNHTCEHNKHTGPCSVNNAGCSHTCLSTMGRVFCLCPDGFM
LEDDWKTCQDVDECSVPDLQTELCRYGCINTPGSYRCAEPMELKDQPVLDSLSITCLPGY
EQTSHGCIDINECVVDNGGCMEVCENTDGSFFCACDGDEKALSSDGKSCVDINSIACLPL
NPVDRGYLICSRSATSKLWRDRRKVPNRPSTRCFLKCPRGYQLRGEYELTCRSDGTWDGP
QHGKCVRYSKPRLECPKDVVAELPPGRDEAFVTFDQPATDLDWFRYVRSKPSWGTRLEAN
LEPGMHEVTFFARHPVSKKQASCVLRIIVKANPKLVGGEAPKVNNCPRDIEVVGRNGTAI
MWTEPTFTDNVKVTRISNNESPGRRFDIGGHRIEYEASDDAGWSSKCVFVVVLRQG
Download sequence
Identical sequences F4WQ46
Aech_07269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]