SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_07762 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_07762
Domain Number 1 Region: 21-256
Classification Level Classification E-value
Superfamily L domain-like 2.78e-46
Family Ngr ectodomain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 254-360
Classification Level Classification E-value
Superfamily Immunoglobulin 3.54e-17
Family I set domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_07762
Sequence length 693
Comment [mRNA] locus=scaffold531:83153:85496:- [translate_table: standard]
Sequence
MLLLLSWGTNAAEDCPSMCACKWKGGKEWVECANRDLKGLPQGAREETQVLDLSGNHLVN
LPAECFRALGLINLQRLYLGKSRINQIASEAFVGLVGLVELDLSENQIEQVPTDTFASYP
SLMRLILNGNPIREIRQSAFLRLVHLTNLEISKCVIEIIEQNAFEGLQSLEWLRLDGNRL
TYVPDHTLPLGGNLRGLTLHNNPWQCDCRLRIMQAWLKESAPAAPQESEPICDSPARLHG
KQIKSLKINELACLPRIDLQDHLDIYEGGNITLRCDVHAIPTAKVTWWFNGEPCELQHEN
NSMASSISTFPRYIRQRGGTNMSSTLFLYSVESLDEGTYSCIAENSAGSAVANLSLRVLF
REKPTVEPPSDNPGSGYVAAIVAGALVGTLLALSCLVGSVIYCAKKRRRDRKRNSKALVT
QSKSVLPITKDTTSSSCRKGNGSLIGGLEHQQMVSYTEREINRAATLERREHTRNNHLDR
DAYSVASPVAKYLTEPDLINEVPENSEVGYGQLYGRHHQRAGGVDRQVLEYDSGYPLQPD
LRPPPVLSQMNYLDQDGYPLNFGLPKITFSTASTLPRLRQRMTEPGSAAAPAARYSREAE
FLARSPGYDPILPRTDARYTAEVSPVAVFPEVPFIPSPPAAYRGETTPLSPRSLLGKTAR
EAAAAAAARAEELQPPNHPESPDEGYVGDAMDV
Download sequence
Identical sequences F4WYB7
Aech_07762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]