SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_07788 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_07788
Domain Number 1 Region: 2850-3025
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.49e-36
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 3288-3470
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.91e-34
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 2645-2832
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.22e-27
Family Laminin G-like module 0.0052
Further Details:      
 
Domain Number 4 Region: 3470-3660
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.6e-26
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 3032-3195
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.96e-23
Family Laminin G-like module 0.0051
Further Details:      
 
Domain Number 6 Region: 1450-1500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000173
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 7 Region: 1893-1946
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000187
Family Laminin-type module 0.0021
Further Details:      
 
Domain Number 8 Region: 490-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000209
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 9 Region: 536-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000273
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 10 Region: 1785-1837
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000131
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 11 Region: 1361-1409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 12 Region: 1843-1895
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family EGF-type module 0.066
Further Details:      
 
Domain Number 13 Region: 444-492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000156
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 14 Region: 727-777
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000279
Family Laminin-type module 0.0063
Further Details:      
 
Domain Number 15 Region: 270-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family Laminin-type module 0.04
Further Details:      
 
Domain Number 16 Region: 1993-2042
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000103
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 17 Region: 329-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000128
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 18 Region: 627-674
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000179
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 19 Region: 582-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000363
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 20 Region: 780-819
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 21 Region: 1744-1787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000053
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 22 Region: 1498-1549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000837
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 23 Region: 399-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 24 Region: 1412-1447
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000156
Family Laminin-type module 0.039
Further Details:      
 
Domain Number 25 Region: 2040-2085
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000265
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 26 Region: 1946-1995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 27 Region: 672-724
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000067
Family Laminin-type module 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_07788
Sequence length 3661
Comment [mRNA] locus=scaffold531:351353:370094:+ [translate_table: standard]
Sequence
MQLPAIFAGLLLIIRLSRSEILTPPYFNLAEGKEIVASATCGVDTTGPELYCKLVGANAD
QDEDINLIQGQVCDYCDPENPEKSHPPEYAVDGMETWWQSPPLSRGMKYNEVNLTINLGQ
EFHVAYVYIRMGNSPRPGLWVLEKSKDYGKTWSPWQYFSDSASDCLTYFGVDSHKPITRD
DSVICTTEYSKVVPLEGGEIPISILNNRPSAKHYFNSTLLQEWTRATNVRFRFLRTKNLL
GHLMSVVRQDPTVTRRYFYSIKDISIGGRCMCNGHADTCDIQDPNMPKKLVCRCQHNTCG
PQCATCCKGFEQKKWRQSTASQKFICEPCNCFGHSDECIYDPNIDEKHLSLDIHGNYEGG
GICQNCKHNTEGINCNRCKPKFYRPWDKPLNATDVCQPCNCDYFYSTGNCSDSTGKCECR
KEFTPPNCDTCNYGYFGYPNCLPCQCDLRGTDGYHCEATDGYCPCKLNYAGHYCNLCAEG
YYNFPDCLPCSCNPLGALDDVCDVISGNCTCKNNYGGRTCDICEDGYFNYPFCTYCNCDA
RGTEPGICDKTDGVCLCKEGYGGVRCDQCTPGYYGYPNCVPCNCSSVGSSSISCDSTGKC
SCLANFAGRTCSQCSPGYYKYPECVACSCDSHGSIGVSCDGEGRCQCRENFDGIRCEQCK
EGYYNFPTCEGCNCDPAGIVATFQGCGSLPPGELCQCKERVEGRICNQCKPLYWNLQPYN
PDGCEECHCNIPGVIGSIGECDTKTGQCICKPGVTDRGCSRCIDGTYNLQENNLFGCSDC
SCDVGGSVNPICDKQTGQCPCQPRITGLTCKEPLKAHYFPTLHQYQYEAEVGKTPSGSGV
PYGFAEDIFPGFSWKGYAEFTNQQKEIILGVGIGKSSLYRMVLRYVNPNNDPVLGTITIT
PDSPSEIEQQFTVNFKPTTRPSFVTVAGAHGNHPLPMVMNPGHWSIKISTKRSMFLDYFV
LLPSEYYEGGILTQDVNVPCEVGYKGLCRHYGYPNLIRFDSVHGAGGFLSENNIRIPLTE
YFTDHETLQEINEDEVPFINNRQEEIHFELRISKPGPHVLVITYVTPRDEQDTSVLLIEA
NTVGKGKVTLNPCRYTSTCRQVVTDTYGKVAVMNFPSNYVSLVLTGEPTSNIAIDSIVAI
PYHQWSLDYIKPKSVCVRKNGKCIQGLFPDAADAKKIEFEISNNILETETRPSGIYDNAT
KLIYLSDGDMVDIHAKVSQPGDYIFVVQYYQPDHPQFELDVLVQNGKFYEAKVPVPHCPS
NSGCRSIIRQIDNNDTRFQLIENFVLTLKEPGHGIWLDYILVIPADQYNEKILSKLQFDE
TNEFIKRCGSNHFHINVTEDGFCRDSTFSLTANYNNGALPCNCDGEGSTSFECEKFGGQC
PCRSNIIGRRCEICKSGFYGFPRCRPCNCPALCERDSGRCICPSRVTGQRCDQCEPGTYG
FHPIIGCEECNCSPLGVLDGDLQCDLFDGSCRCKENVVGRQCDRCRAGYSQFPHCERCDC
DSRGTTADICDQYTAECFCKANVQGQACDVCREGTFNIQAENIDGCTKCFCFGKTTRCAS
ANLYWTHLMDMAGWELITPIDKSGNFTNLSTYPVENATAITVSLIANDTFENVIYFSAPD
TYLNKKLTSYGGYLNYSVYYSTGPFGKAVSAADVILQGANTTLFYYSDEQPPSFVNFRAS
VRLIEANFVTSNRLSATREQIMVILEDLRGIYVRATYWNPSIMASLSYVTWDITTEQYSA
QYSIPAGSVEQCQCPPNYQGLSCEECAPGYYRIKSGPYGGYCAPCQCNGHATTCDVNTGI
CQNCKNGTTGDHCEFCEQGYYGNATVGTPTDCLICACPLPVASNNFATGCEVNEEGNKIS
CDCLPGYYGARCEACAASYYGNPEVYGDYCKPCECSGNIDTNQIGSCDSITGQCLQCLNN
TYGEACNLCAPGYFGDAVERKDCRSCVCDDCGMEHCDSYSGQCFCRENVIGERCDHCAPN
HYGFGTCNGCRPCDCGLASESSQCDGETGQCKCMPGVTGRRCDQCIQGYWNYRRDGCTSC
ECHTGYSVGVSCDTTTGQCTCLPGVIGEKCDHCPYRHVLIPSQGCFSCGSCTGNLLDVTD
ELADLVEPVSREYSTVAEGYFTNQRLKFINDTANELYPEVKLLDPSRVNLLPLQEKLKRL
ENEVYYQKQQIDFTAEDSGKWKDNAENTLQDMNTLEEDVIHKIDLVNQIVSEVQSLALNI
ELGTGAKVDNALNEAKEILKKIKNISFTEFRDNVLDQTDQANILISEMHQYNFPASNLSF
AVTDLNVRIKNISAKMDDLLDTVQIAQDTASIADKLNRENRIAAQSGNLDVVKNSTAEAR
EDLGAGEQLKNNASDFLNHAKINIDLLRTNTDSDVIDRLNNTIALNDEMLIDLAEPVQKA
HAHAAYLHNRSLELDSLLTDTRNTDAVRAVSAYRDIEIAIQAAKDAADNAIIAAENATSL
TDGIEQKMLDSRNECFKLLAAAQFALTKTTGQPENDLRDARNNATLIDTQNKRNKELLDS
IDKTLGNIPSQSSSVAYDAMNQAMNVESNIKVAIDDMNGIVNQIPEDLRETKQLSKNTSE
TIREISQANKQLDGVDKVMPNINNLLNGLNGNQKSIDATGNDLQSKIEALRNKIANAREL
ANRFKTGLTFYRNTTLELKNPESLPLLSTSTKISLYFRTNKTNGFLLYLGNEEKSKLPRS
KAHDFMALLIESGYPVLIVDLGSGPERINHNKFVSDNVWRQIIIDRTGKNVKLIVREDIG
EGKDTLYEKERVLLGPYYIFNVDQEHSKLFVGGYPSSFHIQDAVTASSFEGEMEELMIGD
IPVSFWNFVDGENNQKSALERDKLINFAPSRGYRFDRHGYAILSKKSSQITPDTRKFIIK
LSFKTFVEDGLIYLMGKGRQFLSLEMRNGQLLYQYDLGEGTIVLRSLDKYNDGNWHTLEA
IRQDTMGALKVDDHTVASSQERGTTKPLASSDHIYFGGYPPNAKRPYDSVTNNGFEGCID
DVVILDTSVDLTRNVQAFGVMPGCPVRFASLVSFEKNTPGYVRWRNLASDGLQVNLKFKT
LASDGLIFYATNDDQQNAATSYLSLVDGQLVFTSQGEELRTSPSDVKFNDNEWHVVTATH
DQSALSLDIDDTENYRTDSAPLPLHFLYGNLYIGGLPSNFDLDERKIMPFVGCIGDATLN
SEIIINFANTTERPHAFLGKCKGSDQTLSPPIVEPEFLPPLLPSEGPEDTIESSTQINII
EVDVDKEDEKEEEEEEPELEGRINVDKYDFTTTTTQRPTEQPETIDKCHLPYYPATDPDL
ENAWRFGTARNSRLEYRSLNGRYKDDYDFQIDIKTMADDGIIFYTSDLSKQDLIAVYVLG
GKVHYKFDCGSGPALLVSDKMINNNQWHIIIFKRDGNYGQLIVDDEEAVTAYSLGHTTAI
NVNPPFFVGGVLPEISNIAYTNIGLNKTFSGCIGNFMMNGQLVGEPSEKVGVIPCSKRVE
PGLFFFPGNGSNLFKAVDRFNVDRTVDIQMDIKPRSTSGHLLSVHGKRDYLVLEMINGTI
KFLIKTQRGSIETAFEPTKPNSLCDGHWHNIRAVKQKNAVLLSVDHKPAPPGIGGKNVAR
VLSKHPIFIGGHPMLGKRLRGSTSQAQYVGCINNILINMKPVSIRPERAYGQVVTGVCPT
I
Download sequence
Identical sequences F4WY67
Aech_07788 XP_011062008.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]