SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_09796 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_09796
Domain Number 1 Region: 3165-3423
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-46
Family YWTD domain 0.00000427
Further Details:      
 
Domain Number 2 Region: 1392-1651
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-46
Family YWTD domain 0.00000322
Further Details:      
 
Domain Number 3 Region: 2340-2603
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-45
Family YWTD domain 0.0000156
Further Details:      
 
Domain Number 4 Region: 4033-4304
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-43
Family YWTD domain 0.000021
Further Details:      
 
Domain Number 5 Region: 668-904
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-41
Family YWTD domain 0.0000277
Further Details:      
 
Domain Number 6 Region: 2042-2288
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-37
Family YWTD domain 0.0000305
Further Details:      
 
Domain Number 7 Region: 346-565
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-32
Family YWTD domain 0.0000618
Further Details:      
 
Domain Number 8 Region: 1698-1972
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-30
Family YWTD domain 0.00027
Further Details:      
 
Domain Number 9 Region: 223-323,586-637
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.63e-17
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 10 Region: 1310-1386,1654-1692
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000455
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 11 Region: 2685-2727
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000668
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 12 Region: 1011-1054
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000107
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 13 Region: 2810-2851
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000249
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 14 Region: 160-201
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 15 Region: 1052-1090
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 16 Region: 3519-3560
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 17 Region: 2949-2986
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000929
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 18 Region: 3731-3769
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000995
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 19 Region: 1092-1134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 3772-3809
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 21 Region: 3085-3124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000216
Family EGF-type module 0.037
Further Details:      
 
Domain Number 22 Region: 2649-2687
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 23 Region: 3605-3643
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 24 Region: 2993-3030
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 3977-4019
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000559
Family EGF-type module 0.006
Further Details:      
 
Domain Number 26 Region: 1136-1174
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000825
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 27 Region: 978-1013
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000089
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 28 Region: 3816-3861
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000903
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 29 Region: 1218-1254
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 30 Region: 2858-2894
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 31 Region: 3857-3894
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 32 Region: 3909-4026,4299-4374
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000345
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 33 Region: 3563-3601
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 34 Region: 1181-1216
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000746
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 35 Region: 3689-3727
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000825
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 36 Region: 2773-2812
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000825
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 37 Region: 3481-3521
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000838
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 38 Region: 2726-2765
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000107
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 39 Region: 3110-3157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000223
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 40 Region: 3641-3685
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000034
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 41 Region: 125-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000419
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 42 Region: 3037-3071
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 43 Region: 80-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000183
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 44 Region: 1266-1301
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000183
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 45 Region: 31-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000275
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 46 Region: 2-30
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000668
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 47 Region: 2905-2941
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000196
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 48 Region: 4365-4396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000223
Family EGF-type module 0.029
Further Details:      
 
Domain Number 49 Region: 2294-2334,2595-2658
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000785
Family Growth factor receptor domain 0.015
Further Details:      
 
Weak hits

Sequence:  Aech_09796
Domain Number - Region: 3427-3480
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000233
Family EGF-type module 0.0092
Further Details:      
 
Domain Number - Region: 1978-2024
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00184
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_09796
Sequence length 4558
Comment [mRNA] locus=scaffold331:582022:617118:- [translate_table: standard]
Sequence
MFRCNDGKCIQSILVCDYRGDCDDNSDEMQSCPPPDCEIGQITCGQYSFNKTYCIPPHQR
CDMTVDCVDGTDEDGCTYRKCQPDDFRCVGTTPELCIPKEKKCDGYLDCRNGRDEERCEN
NMKPACRLDQFRCNTTQRCVEQAARCNHWDDCGDNSDEEHCSFPPCTSDQFRCVNALCIP
IAYQCDGYKDCQDGSDEKSCTMTLCPGNKFMCPKGAADGKPLCINRSQLCDGKQDCEDGA
DEEAACSTSMCGSLGCQHKCQASPTGGICYCPEGRILANDSRTCVDRDECFEWGFCEQLC
ENTDGWYTCYCAPGYILHGVNKCRAQNTSSLELLLAQDRAIWRLSSTAEDRRIIANATGA
SGVDYLYSRNLVFWSDMKTRKVHSESLNLGSDTPAKVDISMAGSWGPVSIAIDWIGEKLY
VADSIVQKVDVFELDGRYHGIVVGSNLTNPTDIALDPTKGLMFIADSKQVLRTNMDGTNA
FPVVSQAAYKVSGVAVDIIAKRIYWCDSLLDYIETADYRGHNRVMILRGSQVPSAIRLTL
FENRIFWTDSTKQAVMSVDKTQGDYSIQSVFKIRDAKAIKALHPLSQPSVSNPCGNNNGG
CQHMCIVTASSDQNNRLGYRCACHIGWRLAGDMRNCNLVQEFLMYSQQRFIKGRVLNPVM
EGFSDAILPVASRRARFVGLDYDAHDQYIYYSDVLQDVIYRVHQNATGREIVLASQNEGV
EGLAVDWAAKNLYYIDSRKGTLNVLSTRNVTYRRTLVKNLKRPRAIVIHPNQGYIFFSEW
DRPANISRSHADGSNVVVFRNLTLGWPNGLAIDFTEDRLYWCDALLDNVQHSNLDGMDVR
TVNSKLIRHPFSIAIHEHWIYITDWRLDAIIRLHKETGEQEAILVREPATNRLYGVKVFS
RDIQRTTNNHPCTINNGGCEKFCFAIPDNSSRSDIMFPGMQSVPKLIQVCGCPYGERLQG
NGRSCAADPDGEPPLQACPHTWDFTCANQRCVPKSWVCDGENDCLDNSDEMQNCTKPTCS
ANEFQCKSGRCVPMTFHCDSENDCGDYSDEMGCPNVTCSANQFACANNRCIPATWKCDSE
NDCGDSSDEGEFCAAKTCSYFQFTCPRSGHCIPQSWVCDGDSDCFDRQDEMDCPPVTCLS
TQFTCVDRKMCVLASYKCDGISDCNDGSDEVGCPSLAPDQCNTDKQFQCVISGICIPKSW
HCDGTADCPDKSDEPESCGKVDCQTGFFRCRNERCVFKAYICDGKDDCGDGSDEDIELHA
CGPPTFKCDSQQWKCPNVKNRCVNTTSVCDGKLDCPNGADEGPGCDTAECHHQDGLCTNG
CIQTPFGAQCICPAGEELNDSFTCQDINECDPDGRCSQLCKNTKGSYYCSCVNGYTLDAD
KHTCKAFNHSAAFLIISNRHTILVADLQDQALERVPINVENVVATASNMHTGTIFWSDMK
LKRISRLDRGSDPQDIISTGLDLVEGLAYDWIGQNLYWLDSKLNTIEVAKETGVGRMILV
KENITQPRGMCLDPSEGARWLFWTDWGENPRIERIGMDGTNRSTIISTKIYWPNGLALDI
ANRRIYFADSKLDFIDTCKYDGSQRLQVLASSHYLLHPHSLTLFEDTMYWTDRQLNRVLS
AHKFKGSNQTVVSHLISQPLSIHVHHAVLQPITANPCANTSCEHLCLLSPNPKGYSCKCQ
VGFKLLSDGRCMEEETPYLMVLRGSQIIDVSLTPKETKTGYITPIVGVEGGRFIEYDRRD
RTIYWLQSKDSDNENGTIYVTPYNGGNRTEFPNPSGDTGIVGSPSTMALDWLGRNMFIGN
KFASNIEAIKLDGKTRFRTIVLSNDGNRTSVSKPKAMCVDPIDGQVFWVDDGGFGVPQKI
GRVNMDGSNPLVLVESLERPEAITIDIPSKTLYFSCKNPVFIKSMSTDGQNIRTILTAAN
NIAMPKAIAVHESRLYYLDSLFDKIERVDLSNGDNPVIIIDNDSELRTLTIYKKRVTGSH
PCLINNGGCEQLCLPASGGTRVCACGMEYKKVTETRCEPYKTFAVVTQLDVARGYSLKDS
KEAMIPITGPGHHILHVDVHYAGNWIYWVEFNRGFWNGIFRIRPNGTELQQIIKQGIGSN
GIRGLAVDWIAGNLYFANVFPHDNYVEVCWLDGSNRKVLVKMTTDAPRELAVNPIKRYLY
WIDYGQYPRIGKAFLDGSNWSPIVTSGISTPRDLTIDLATHDVYWVDSKLDTIQKVSYTG
GNQEIIRRNVPNPMGVAIFGGDVYWVDRNLATVFKASKLKGNTSLPIPVRTNLQKLRDIA
IFDQNSQPPDITNPCAQVTNGGCSQLCFAFPKDSPKSFTCDCAVGELSPDGRNCENVQEY
LVFATRTEIRAINLDPHNTNMPFAPVGNLTNVVGVDFDYQDKKLLFTQIRPWAKIAWTPS
DRPSSSDLHTLISKGINPEGISYDWTQKKVYWTDSSNNSIYAMDIDGSNLVMIARVDRPR
AIVVDPCNGSLYFTDWGRFGTSGKIFKTTMAGSLKRTIIDKDLSQPSGLAIDYEDRMLYW
TDAVREKIERSDLEGKHREILVSATIYPFAITVYKEHIYWTDLQLRGVYRAEKHTGADKI
ELAKRLEDSPRDLHVFSGGRQICSVNPCNISNGGCDQSCHPGNNGLPECKCDDNSRLVNE
NRMCVPKNVTCDRNKFACRNGRCISRMWACDGDDDCGDESDENTNYCSHHSCSPNEFRCN
NGRCIFKTWKCDHENDCRDGSDEEGCVYPPCASGEFTCTNHRCIPQSQVCNGINDCKDKD
TSDETYERCPRNTTCPLNHLKCEKTNICVEPYWLCDGDNDCGDNSDENPIHCAQRTCPQN
SFRCPNHRCIPATWYCDGDDDCLDGSDEPPGYCQSEGRTCFGDLFTCDNGNCIPRIYICD
GDNDCLDNSDEDERHQCNDRKCDEETEFTCTANKMWNRAQCIPKKWLCDGDPDCVDGADE
NVTLHHCPAPTPCSDNQFTCKNGRCLNRSWLCDHDNDCGDGSDEDKFCNTQYKSCNSQEF
TCQNFKCIRKQFRCDGQDDCGDHSDEVGCPSKGKNTTCPNPKDFMCANGNCIDSQLVCNK
EPDCADESDEPLHCNVDECARVEINQCGQKCVDTPTSFYCECNPGYKLLADGKACDDIDE
CIETPQVCSQQCENTPGGYYCKCNERWYEREADEHTCKRRDNVQPWIVFTNKYYVRNMSI
DASQYSLMHQDLINVVALDADYAQQMLYFCDVTAKTIYRAPVNGGEREPIIRHDSLGLEG
IAIDWVGRKLYWLDRHAKHLDVAELDGTNRKTLQSGIADPRAIAVHPGAGYLYFTSWHLQ
AYIGKMGMDGSNFTRILTWEDDIAWPNALTIDYFTDRIFWADAHLDYIAFADLEGHNRRI
VLKGASVPHVFAITVFDDFIYWTDWNLKAISRAEKFSGAHLQVLRNTTHRPYDIHAYHPL
RQLPYNNPCANNNGGCSHLCLIAPPASSYLLEGYGQPGVTSYKCKCPNQFILDKDDKTCI
ANCTAGQHRCGPPDEKCIPWYWRCDGEKDCKDGTDESSFSCPPRICRPSFFQCANRNCTP
SVTICDGIDDCGDKSDEAKCALECGELEFKCKSNGRCVHDSWKCDGDADCKDGSDEDPSI
CHNRVCDPSTEFSCKNGKCIPKLWMCDSDNDCGDDSDEPAYMCRQRNCTTGWQRCPGHAN
YRCIPKWLFCDGKDDCRDGSDERPENCPKCDPTLDFKCTNNRCVPKQWLCDFADDCGDGS
DEADAMCKDKYRQCSESEFKCKNGKCIASRWRCDNEDDCGDNSDEEQCHQWVCKSDNFRC
ASGHCIASYLHCDGSRDCRDMSDEINCTPRYPGGRYCPQSRFQCNNNLCVSLNDICDGTD
DCGDNSDENATMCANFQCDTHRRFQCANHKCIARYQLCDGIDNCGDGSDENNMTMCVKQT
RPCDLITEYTCANKKCIDHLKLCDLADDCGDLSDELGCHHSHHCSDNDRGGCAHVCHNLS
DSGYICTCYPGYIISQDNRKHCVDVDECQTGNHQCSHICTNLNGTYACSCRHGFQLSDRH
SGVCRAEDDNVVVLFANGPELRAYDLRTREEMDVIDNEKRVEAIDFDPRTEYVFWIDSYD
NTIKRSYMVNAKEGEAKIGHAQDLNMKTDSRPTSLAVDWISGNLYWSEIDQSGTTPRGQI
MVAKSDGRYRRSLITTNLEQPTAVVVDPERGEVVWADSGNQPKIEIAWMDGARRKSLVTE
RIASPSSLTIDYAMEHTLYWSDSKLDTIEAISLAGTNRRTVLKGRLLKNPIALDVFENNL
YWTTKQTGELIRQDKFGRGVPHIIIKNLPRPGGVRVYHQQRYNTSLRDPCHNDQCTHLCV
TIPGGHRCLCSDNVGPFQLLMRGNDNERHCDATNERPLPAPRICRCQNGGWCQELDDKLA
CNCREEFHGEFCEMAAIAARAGGSTAAIVIPIIICLLVLFAAAAIFMVLKKRPFGKPGGL
GSLTGAQSVSFRQGSNVEFGAEAHERMEPLDVEYNLNDVTNKNRDFSNPMYDAVNMESGA
TNGTGTGSLFEVPAEMKPSSIQHKELPQLHLKRRELDPTPIDSGKDTQQLVEEDKSEC
Download sequence
Identical sequences F4WMX5
Aech_09796 XP_011056133.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]