SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_10970 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_10970
Domain Number 1 Region: 889-1073
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.56e-22
Family Laminin G-like module 0.018
Further Details:      
 
Domain Number 2 Region: 1093-1289
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-22
Family Laminin G-like module 0.0092
Further Details:      
 
Domain Number 3 Region: 385-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000017
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 4 Region: 690-733
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000286
Family EGF-type module 0.003
Further Details:      
 
Domain Number 5 Region: 613-655
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000439
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 6 Region: 273-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000602
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 7 Region: 234-276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000698
Family EGF-type module 0.005
Further Details:      
 
Domain Number 8 Region: 195-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000111
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 9 Region: 348-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000348
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 651-694
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000109
Family EGF-type module 0.0024
Further Details:      
 
Domain Number 11 Region: 530-655
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000124
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 12 Region: 1622-1750
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000132
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 13 Region: 1391-1527,1572-1589
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000245
Family Laminin G-like module 0.07
Further Details:      
 
Domain Number 14 Region: 158-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000387
Family EGF-type module 0.013
Further Details:      
 
Domain Number 15 Region: 1327-1362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000839
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 16 Region: 423-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000104
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 17 Region: 1786-1830
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000024
Family EGF-type module 0.022
Further Details:      
 
Domain Number 18 Region: 116-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000675
Family EGF-type module 0.01
Further Details:      
 
Domain Number 19 Region: 788-832
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000167
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 20 Region: 77-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000168
Family EGF-type module 0.02
Further Details:      
 
Domain Number 21 Region: 1835-1873
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000939
Family EGF-type module 0.007
Further Details:      
 
Domain Number 22 Region: 1907-1947
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000503
Family EGF-type module 0.018
Further Details:      
 
Domain Number 23 Region: 461-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000131
Family EGF-type module 0.018
Further Details:      
 
Domain Number 24 Region: 828-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000712
Family EGF-type module 0.0087
Further Details:      
 
Weak hits

Sequence:  Aech_10970
Domain Number - Region: 1743-1788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00129
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 771-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00145
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 1867-1906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0046
Family EGF-type module 0.0095
Further Details:      
 
Domain Number - Region: 728-748
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00602
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 503-540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00839
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 311-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0104
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 1363-1396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0757
Family EGF-type module 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_10970
Sequence length 2020
Comment [mRNA] locus=scaffold519:85323:98028:- [translate_table: standard]
Sequence
MVANTTYNSAILTLPDYNVNSSLIVGEGFRGCILQGPGILFNNSINNGAVFGPCSDIKGC
GTSGLGTGVTSATMATMDFCHHEPCMMHGKCVSRQDRYECHCYARYSGNNCQIDNGSPCQ
NTPCRNGGTCSEDVRGDFSCSCKPGFTGSFCESQLGVRLCEQNPCRNDGICMALTDSEYK
CQCQPGWTGKKCETNINECASNPCKNGGICIDGINNYTCRCDRTGYEGLNCDVDIDECEA
NPCLNNGICYDYYGAYICHCPTGFEGQNCELNLNECLIEPCANGGKCIDDVGTYHCECIP
GFTGRHCELRGLCENAACPPNSICVEDSHGPQCVCNPGFMGNPPNCTVNYCASNPCANGG
TCTSGKDGFNCTCLPEWRGKNCQIDIDECLSQPCQNGGTCIDRVNGYTCNCTRDFVGDNC
EREYDACVINPCQNNGTCMLMPRSKREFVCECLHGFEGKVCDVNIDDCIDVMCPDDKICV
DGIANYECKCREGYRDPNCTLIVDHCATKPCNNNSTCIDLGDRGFECKCQYCDLDVNECE
LHGNSLCNNGICINTEGSYNCFCRPGFSGDHCDINIDECLCGPCKNNATCLDGINMFQCV
CQPGYTGKTCEIDVNECDSNPCHNGAQCVNGIASYTCVCPVGFLGVNCEINVDECESSPC
MNQGKCIDGINGYTCDCSDTGFEGLHCENNIDECLPQPCVNGGLCLDDIKSYKCQCYTGY
TGKNCEIDVNECESSPCQYNGTCLERSNKNLYKSEALNLPAIFTQEFNYTNASGYECLCV
QGVTGKNCEVNINECDSNPCGPGTCMDRIGGYTCDCDEGYEGDHCQHEIDECKRYSPCEH
GVCTDGRADYFCTCESEYGGKNCSVKLMGCQGNACQNGGTCWPYLVDETIHKFNCTCPNG
YHGEVCDYVTTMSLSGSSYVLVNTTRDEGYDIQFRFRTTLPNGLLAIGRGVTIYILQLVN
GKLNIHSSILNKWDGVFVGSGLNDSNWQKAFVAINATHLVLSANEEQTIYPISPNEGSNS
SSFLRRLSRLSSFTFFVGCMEDVVINGEWVYSGTTSKTMYMEDVEAGCPREAQCSPNPCK
NGGHCTDRWREFYCKCERPYLGHTCQYNMTAATFGYENITNGYVTVRVSDAARRTVSSVV
DISMFIRTRESYGDIFYLGTEPDSQIDQKSQEKTYIAAQLEGGELRVRIQFNGTEAYSVG
GVKLNDGNNHLIQVVRNVTLVQVKINDTEYFRKTISATGDLNVTVFYLGGLPQSSRYIRQ
VDSRQMEVQQTPQINFKGIIQDVKISNGTKTMVVEFFPLKAQDIPALIQFGNVSFDPEKV
LEGVVTDDVCVSNPCNHNGTCHVTWNDFWCQCPRGYTGKTCQEMEFCQLQDCPAGSRCQN
LDDGYECIANATFDGVSTLFTYTYGRVTDTASDLPLDTIEITYRSNTGGTLLHIAPHMGD
QHFTVFIFKDNVTVSWRLDLENQNNVSFGKSQPDGNWTSLLIKLNNNSVECGYANPTEEQ
PRMSLNFSFQLWYDLLITGTVTLGGISSSALSDKDTYLTVGSRPENRNGIEGNSVDYEHR
LTTTMPPHSMISGEPFKGCLGEVRIGSILLHYFTYEEVYQNANFTPLEYLELRDNDNATH
RDSIGCQLCFDMDCQNNGYCFDKANSYVCECPAGYAEDDCSFNIDECIDNKCQNGATCVD
GIANYTCVCKNGWQGWLCDSDINECVTLSPCKHEGVCVNLPGSFRCECPDQFTGELCESF
RLITCKNEPCKSGATTSCLDEPNPKTGNNFTCNCAPGYDGPTCDTPYCFHTKCQNGGRCE
FLIPYKAPKCICPVGYTGTYCEINIDDCAVDSEGNGPCQNDGKCYDGVNKYVCDCQGTGY
SGINCSIDVNECQDLEIDCGHGKCENLPGIYQCICDDGYCGYNCGMANPCQDDFCHNGGT
CECGDDGEYICRCTPNYTGRNCTELEYNYLSGQALDIVVIVGPIVGCLLLIAIVSLIALF
MMARKKRATRGTYSPSAQEFSNPRVEMDNVMKPPPEERLI
Download sequence
Identical sequences F4WXJ1
Aech_10970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]