SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_11329 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_11329
Domain Number 1 Region: 11-243
Classification Level Classification E-value
Superfamily L domain-like 9.07e-43
Family Ngr ectodomain-like 0.0029
Further Details:      
 
Domain Number 2 Region: 239-336
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000516
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_11329
Sequence length 739
Comment [mRNA] locus=scaffold59:189832:193529:- [translate_table: standard]
Sequence
MQCLSTCKCKWVSGKKTAECIKQDLTQVPGDLSPEIQSLDLTGNRITHLARNAFSRVNLV
NLHKLSLRDCGIELINKDAFSDLKIIIEIDLSGNNIHSLHPSVFYETQKLRVLLLNQNKL
KVLDNGLFFNLTFLQKVTLSDNRLERIEEQAFRNLPNLHSLALDGNNFSTLQLQSFESLP
KLGSLELQNNPWNCNCHLKKFRDWAIQRKLYTQPTTCQQPLHMIGKMWDEVSSDDFACRP
KITNIEPSNKIEAAKGDVTISCRATGIPRPELSWTYRNRLITNSSKHGNDKNYLLLENHD
WLNLTIIDALPADKGDYICHAKSPGGEAEKNVTVSIMGDALSGRENFISLPLAIGLGVTA
LCLLIVTVVLCVCYCRRRHTRHDEKGLEAASLEHHGLGEQEKSLITTINPVVKPPRRYEA
PSVTSHTDGVGSGVVGGVGGGVGDDEKEHERATPELDGSGNGGVVGGGGGTLPRGGAGYH
HRQYPPDLLAFSGGRGASPTSQASTAPDSTRLPSQQMIAPAAAATTAATASSYGSPPSGQ
YHPAAFKTLPHSRSATPYSLGPSSSSSPLAPVLPRHGYVTIPRRPRAPSWSSAPPTSPTD
ALEPVYDNLGLRTTADGSSMLSLNKSPESVASSMRGRPLPGTPGGSHYGSIQRSTPNILT
SNPLDRVAPEGAAEWPLKLTDESMDGGHLLLTQQQQQQQAAASNTLGRKVPPRPPPKPKK
KSANGPTLYEDEGEDGTEV
Download sequence
Identical sequences F4X0V6
Aech_11329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]