SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_12099 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_12099
Domain Number 1 Region: 178-498
Classification Level Classification E-value
Superfamily Kelch motif 3.53e-48
Family Kelch motif 0.0025
Further Details:      
 
Domain Number 2 Region: 2-79
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000353
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 
Domain Number 3 Region: 774-823
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000385
Family Laminin-type module 0.057
Further Details:      
 
Weak hits

Sequence:  Aech_12099
Domain Number - Region: 87-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000377
Family Integrin beta EGF-like domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_12099
Sequence length 1154
Comment [mRNA] locus=scaffold296:884512:892375:+ [translate_table: standard]
Sequence
MHVEQFATECGWDHLYIYDGDSVEAPLLAVFSGLMHKDSYHIRRVPEVIARSGSALLHFY
SDVAYNMSGFNITYKINACPSRYSHIDCSGHGVCIEGTCTCDAMWTGEACDVQVCPNNCS
FHHGQGECDRESHHCRCFHGFKGADCSQKGDRGFWESVTYKDLPPDGSASHCSIVWKDSL
YVVGGESFHRAKMIYVYDYNGNVWETPHVEGRMPLPRYAHSCVLFGDKIFMYGGVVENST
VTNEIWAFDVSAKIWENVTVHDNCHNKTICGPLKVAGHTATRVSHGKKEKMVVIFGYSPQ
YGYLNTVQEYSLGTREWQIVKTSGFPVRGGYGHSSAYDPLTNLIYVYGGYVSESQSTHIL
SSRLYSYHPNYCEWRLLTSAPSARFFHTATFVTSGLMLVFGGNMHNDTQQSHGARCYSAD
TLGYDVTCDTWHQYTMPRDMSDLPRYGHSATVFEKSMYIYGGFDGEMLSDMLRYTPGNCE
HLTNQNQCLNARIGVKCVWHKRDNRCLQITKIPQHVLNHKEYDEHDGIYMKCNLDDKPPR
GMTSHAELCKLFTDCVTCVQTSYNCVWCGKSCLHMSCRDNPNSPNSAITELEHCDQNTGI
ECLQLHTCHACSSNPRCIWSWSNGPDRCKPQSKIREVNMLNSTIQPQRLTMDPCRSPCAE
YTACRNCTESDCIWCQNEAKCVDKNAYPASFPYGQCREWTTIDARCRATETGREWCSFYS
SCAACRSDPGCGWCDDGSDTGKGSCMPGGARGPSSKTSNTCLLEHWYFTKCPTCQCNGHS
RCLPNTSECIQPCGNLTYGSHCDKCIPGFYGSPLNGATCQPCSCNNQGTLCTSETGKCYC
TTKGIIGDHCERCDVSGLYHGDPTINKGSCFYDLAIDYQFTFNLSKKEDRHYRAINFKNS
PPKADIDAEFSITCSVLAKMNVSIKKVNSDEVKLVTNANCTTTMYKHRFSKADYNFGSED
NNTLTTFYVYVYDFQPPLWIQISFSQYSKLNLQQFFITFCTCFLALLLVAAILWKIKQKY
DMYRRRQRLFLEMEQMASRAFSQVLVEIERRDVDNSDSERGDADFTNCRKKKKNAPSPIA
LEPCCGNRAAVLSLLVRLPTGGEPYTPAGQSAGLAVASALVTLGSPRRPSQELTTKEPKK
TRKSASQHPDSTCI
Download sequence
Identical sequences F4WJL9
Aech_12099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]