SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_12288 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_12288
Domain Number 1 Region: 630-665
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 512-551
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000838
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 590-625
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000746
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 4 Region: 555-588
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_12288
Sequence length 670
Comment [mRNA] locus=scaffold633:76322:90692:- [translate_table: standard]
Sequence
MENQGYEEDQSRAAQEQSTLESRRRDQQLCTDTIDVIDNPVVARATSHPESNLYEDIAIG
AETNTSELSKRTSYPDESRNLSETGGLLARQAWINRPSSSTIDRPFQQNSTLSSRISTNH
DSIITLSRTSEDDAEKVFEKSRELPSLSEDVSENVSLSLQANEDSQDASMTQFDRRPNRR
RRKKDCKHCRSKLADVSSCEKFDELIDSKDTILKENGDNHRDRHPDASTLLFRESLLRPQ
NIKVYPIVSRTSLRDIGAKRSSSAAFPASERAYSLPARTHTPTSQNRANLRRSVRNEPPP
QPARLDKHRRGWTLHLARPLKASGCSSPLIPLLIVVLILLGVAGVALYIVFEPEKLQIIQ
QYLKSSTSRLTGQNVTSGEPITPTNDESNLTTAMTDTMTLTSMTDIEETFAGGMFAMSAP
ISGNLSFPGSTSPSNEGLETEAASQNVINATRYCDDCFEGELCVAIFGEMVPICRKIRDH
SDPTGCGGFCILNRQKCHRLDMDAFRCERVERFFCLENEWTCSNTLCIPLDKRCDGHMNC
YDHSDEYDCVCNLETHFQCGNKTSCLPLERRCDRKIDCWDATDEINCTLVCSLEAEFTCI
NGECIQRDRFCDGLADCSDGTDEPHGCQGRCNKHEFTCQNSRCIAKRMKCNGFDDCGDGS
DEIHCKDRFI
Download sequence
Identical sequences F4X1S2
Aech_12288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]