SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_13392 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_13392
Domain Number 1 Region: 179-420
Classification Level Classification E-value
Superfamily vWA-like 1.11e-79
Family Integrin A (or I) domain 0.000000581
Further Details:      
 
Domain Number 2 Region: 414-508
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-18
Family Integrin domains 0.0011
Further Details:      
 
Domain Number 3 Region: 690-774
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000000000123
Family Integrin beta tail domain 0.0013
Further Details:      
 
Domain Number 4 Region: 37-90
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000523
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 599-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Weak hits

Sequence:  Aech_13392
Domain Number - Region: 649-688
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000148
Family Integrin beta EGF-like domains 0.0093
Further Details:      
 
Domain Number - Region: 519-545
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.082
Further Details:      
 
Domain Number - Region: 567-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0474
Family Integrin beta EGF-like domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_13392
Sequence length 873
Comment [mRNA] locus=scaffold546:212091:217314:+ [translate_table: standard]
Sequence
MFGSSRWILVLGVLATSLSASFAQANYPLPPPERLTGMNPCISKQTCHECIQTPHCAWCA
APKFSEKRCFLPNINTKISATCPPESIWNPDIVFIRLRHRNLTKGGYAIGGGGGGGYGSI
ESSYSNFSSSSSSSSHSHKESWGGSGSRRQEAVQMWPQEVNLKLRINEAYGMHFAYSQAE
DYPVDLYYLMDLSKSMEDDKKKLSDLGQLLVESMSKITSNFRLGFGSFVDKVVMPYVNTV
PKSLIEPCDGCAAPYGYKNIMRLSQDTSKFAGLVRNASVSGNLDAPEGGFDAIMQAIVCR
NQIGWREKARRLLVFSTDAGFHYAGDGKLGGIIKPNDGFCHLDTSGMYTHSSLQDYPSIS
QINLKVKQNAINVIWAVTEEQINVYKRLTKQVEGSFAGKLSDDSSNVVELIREQYDAISS
SVEMKDTASSAIKVKYFSSCLGTGPVVETSKCDGLKVGTKVEFIAEIEVTSCPANRSEWK
QKFDIYPVGINETLTVNLEMLCDCECERQGHMYEEHAPECNGMGTLKCGVCECYDGFFGK
HCECSSHQELTGFDKHFQSCRPDNTSLVDCSGRGTCACGQCECEERENPDEIISGHFCEC
DNFSCDRDQGKLCSDHGTCECGQCVCNSGWTGPSCNCRSSNDSCIAPGTTNGVLCSGHGD
CICGECICHEEGSIRYSGKHCNKCPTCPSRCEELKPCVQCQMYGTGNYSVPEECARNCKE
FVPEGVETVIVDVDNDEVPCFGTDEDDCKYNFVYYYNETNCLQVRAQNERECPPQVYMLG
IVLGVIAAVVLIGLALLLLWKLLTTIHDRREFARFEKERMMAKWDTGENPIYKQATSTFK
NXXXXXXXXXXXXXXXXXXXXXKKNSIKNLVRY
Download sequence
Identical sequences Aech_13392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]