SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_13617 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_13617
Domain Number 1 Region: 7-228
Classification Level Classification E-value
Superfamily L domain-like 2.1e-43
Family Ngr ectodomain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 224-323
Classification Level Classification E-value
Superfamily Immunoglobulin 5.19e-18
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_13617
Sequence length 604
Comment [mRNA] locus=scaffold532:69158:70972:+ [translate_table: standard]
Sequence
XESGTRDLTSIPEWIDPETQVLDMSGNNICHLPNNIFIHVRLTNLQRLYLRECRIDRIDS
EALAGLTNLVELDLSNNMLAAVPSLSFTDTPFLRDLVLAYNPLKRIRSHAFKSTPNLVKL
DLSHTQLVEIEAKGFRGLEMLESLKLSNNELSTLHQGTFEPLNKLTSIELHENPWICDCH
LREMKMWLVKHNLPTIVAPVCHGPQQLLDRAFTDLGIDDFACRPILLIASRYAEATIGEN
ASIVCHVRAVPAADVKWYWNGRLLTNHSAFSSYQKILIFEEGQFRKRSTLILTNAQEADS
SEFYCVAENPAGSVEANFTLHVSLRTAGMSTLGSGQIAGISAALVVLILFILLIILVLFI
RLRRMPLKDMKSSAPMEAASSDGVGNGGSGGGGGGGGGDNNPSSATSTTRRKHEEIETTS
FALESKPPASLHLSYVQRPHAAVMQDNEYSTISRFDDQNQPAMAAMPGAGCFSSTTSLMP
IDNPDLIRDTRRGSTEDITPYGVTDYGRVEALDDAGKMLYTSCLWEARDSCGRTSAVSAN
VYPSKEQLAVVAPVVEQFPPGAKQMRVWQKGVPVLPPVSALKRVLGSTRSSPDEGYQEGT
GTDV
Download sequence
Identical sequences Aech_13617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]