SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_13754 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_13754
Domain Number 1 Region: 91-271
Classification Level Classification E-value
Superfamily vWA-like 2.92e-36
Family Integrin A (or I) domain 0.00088
Further Details:      
 
Domain Number 2 Region: 1402-1597
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.42e-33
Family Pentraxin (pentaxin) 0.00059
Further Details:      
 
Domain Number 3 Region: 2098-2168
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000085
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 4 Region: 2035-2105
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000347
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 5 Region: 393-465
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000135
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 6 Region: 1693-1743
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000031
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 7 Region: 1243-1285
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000168
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 8 Region: 469-537
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000195
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 9 Region: 1767-1821
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000729
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 10 Region: 1201-1247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000012
Family EGF-type module 0.014
Further Details:      
 
Domain Number 11 Region: 1360-1400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000028
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 12 Region: 1161-1203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000127
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 1868-1914
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000236
Family Complement control module/SCR domain 0.0042
Further Details:      
 
Domain Number 14 Region: 2158-2212
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000105
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 15 Region: 522-584
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000114
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 16 Region: 1028-1143
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000248
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 17 Region: 1603-1675
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000123
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 18 Region: 1276-1317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000176
Family EGF-type module 0.013
Further Details:      
 
Domain Number 19 Region: 1317-1367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000427
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  Aech_13754
Domain Number - Region: 289-438
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000306
Family Growth factor receptor domain 0.0052
Further Details:      
 
Domain Number - Region: 760-832
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0799
Family Complement control module/SCR domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_13754
Sequence length 2218
Comment [mRNA] locus=scaffold702:84708:101084:- [translate_table: standard]
Sequence
MRFSRILPLLIGVLSLFSNFAECVDDDDGGSINSVENGRNDNNVSSTFLNFDQKTNENQR
KHLDDADRMLSKMDILSRLLKMHIDQLRNKTDQVEMVFLVDASGSIGAENFRSELNFVTK
LLSDFTVDALAARIALVTFGGRGSVYRNIDQISRHGPNDHKCYLLNKQFSNITYSGGGTY
TRGALLEALAILEKSREAANKVVFLITDGFSNGGDPRPAAHLLKNTGAIVFTFGIRTGNV
EELHDIASHPEYTHSYLLDSFAEFEALARRALHSDLKTGQYVAVTLPTDCNSLCSDNVNR
TCCDELATCTCGTATGHYACICPPGYFGSGLRGFCQPCSNGTYAFANTSGDSTSACVPCP
DANHITIKIPATSMVDCVCASGFITDGYKCEAITCPKLRIPDNGYLVKASACSNVVHAAC
GVRCRIGFHLTGDSIRLCGKDGAWSGNEPQCLLKTCSALRSPTHGRVKCEHDEDYQQQFK
ENSTVYPIDTRCQFRCDVGYQLRGSKVRNCLPLSRWDGLKVTCKAVKCEPLPQIANGDIT
PEICIGPAKVPFATNCTITCNEGYILEGPTDRMCIGRTGIWSQRHSVNRCVDKTPPSLEC
PADVIEETEKGQSYAYVNWTVPKVTDNTDASPIIWTKPHIVLPWKIKIGTRIVVYVAQDA
SGNKARCKFKVKVLDRESPTIENCIDPPIFYTDFGNGLANVTWDEPVFYDNSRIAVRVNQ
SHQPGQDLFFPVGRTKVFYNATDKYGNRASCVLNITVEDVCKSLKAPANGRLNCSSSDDR
ETRCVVACEDGYDFAIEPVNFNVVNDELLLKCNSSNHMWNSNYLPECSETQTPIIISQEG
DVILQSNGSAICDNQPALDELNKHIANDLKSKFLEICDNDIECDLVSFDPKCEDDLSLSK
DIEDNLIRRRRFELQYKQVRSTDTFKDIETTLFERLKRAAIRLSPEPNKNNIRSKRKKNR
IEIKFKFIGKIIEENYENPKRGVQKLREKIDAMAQVGKLNLLDNRTNQEIAKLALNLHFV
FKEPQDLCDPGSVLKKHGCVKCPAGTFYNSSTRTCQPCPFGEYQDAIASLTCVPCPEYTF
TKRMHTRALKDCIPVCRPGYYSRRKRYHGSRVGMEPCFACDIGFYQPNYGQSQCLPCPSN
VTTEKRGSIDISDCLPIRDEEIDDCRTDPCLNGGRCLRDESGYVCECREYYAGSKCEEFK
DPCDSSPCLNEGMCTTWQYLNNSVIYECVCKSSYTGDNCEIYVDECYTNPCQNGGRCIST
ENDFICDCRDGFEGQFCEVSMDHCDHMPCEEGSMCRTVNGTWQCLCKPGFLGRHCNLLPC
DWLPCHSNAICVNVKEENATRKSYRCECPEGYTGEDCATKINHCEYLPCLNNGHCINFVH
DYLCECPIPFTGRDCEIELSSDYVMHFTKSGTTDYVAAKGPARDLLQLSVCLWLQSLDTF
NYGTILSYATTFYDNAFTLTDYNGLVLYINGEKIVTDVKVNDGNWHFLCVTWESESGSWR
VFVDGILKDNSIGLAQGAVVRANGSLVIGQEQDRLGGGFSESEAFLGRLGLLDMWDVVLN
ESDVTKLWNSCEKYHGNLVAWAQMRQYIHGDIVILASPFCHGCPLPVVPFKGNVKVSEDL
SEITYYCDNGYVIRFGNEEYRSVRRKCLKHGQWEGYNTPICMRTTCKNLLAPENGDIEYI
LEENERDDVTILQAGQQLEFKCNPGYRLIGERYLTCLDIGVWDHKRPSCTPYGCPLPKQI
EHGYIIPSNSDPTSVRDPERNIIDNFSERTYHYNDIVGFSCHRGYKFRNNHNLTEFKLQC
STNGTWTSFVPDCVPRTCPWPDRVADARIFLKKPDNITVEIPMEEDATWKPDRRRSNESD
AESGIPPETFISGAEIVIVCDLGYELVGDQIRTCTEEERWSSTFTSCEPRNCSVEEHPIF
KYFKKLENETTLENNNTDVILFELDEKQYSKENVTHRYKDFDIFVERNSYKGRIVLTCRN
DAQMNLHKLIVNETISNITWMCNKIAKWEVSNLSLKESILEQLLNNLTDVCDRSCAPPQI
PEYGYIDNGNNTDNVNNRRTINSVIIFKCRHGYILEGAEQSICLSDAKWSALPSCKPVAC
GKPPILANAILKSDVDGTQNYTFGNMISYQCVPGYRVFGQASLRCLGSGKWSRLNGRCSK
ISCGKPQIQHGIALYGRSYLFQDQLTYICLNGEKKGMITCQADGKWNELPKCDGNRNV
Download sequence
Identical sequences F4X475
Aech_13754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]