SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_14484 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_14484
Domain Number 1 Region: 728-781
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000165
Family Laminin-type module 0.001
Further Details:      
 
Domain Number 2 Region: 628-679
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000809
Family Laminin-type module 0.0098
Further Details:      
 
Domain Number 3 Region: 839-889
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000123
Family Laminin-type module 0.0092
Further Details:      
 
Domain Number 4 Region: 182-244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000446
Family Laminin-type module 0.094
Further Details:      
 
Domain Number 5 Region: 345-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 6 Region: 784-835
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000142
Family Laminin-type module 0.0026
Further Details:      
 
Domain Number 7 Region: 242-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 8 Region: 298-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000206
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 9 Region: 887-933
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000474
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 10 Region: 590-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000949
Family EGF-type module 0.082
Further Details:      
 
Weak hits

Sequence:  Aech_14484
Domain Number - Region: 688-730
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000193
Family Laminin-type module 0.0092
Further Details:      
 
Domain Number - Region: 985-1153
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0116
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.02
Further Details:      
 
Domain Number - Region: 1191-1310
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0245
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_14484
Sequence length 1497
Comment [mRNA] locus=scaffold740:15283:28552:- [translate_table: standard]
Sequence
MRGIWGLLSLVGSCVVLADPEADPSEELFSRLQLPKNRNEDKCYDENGRPQRCIPPFENA
AFNVLIEATNTCGEDRPIEFCKQTGVQKKSCEICRRGDHSASFLTDHDNNDNATWWQSDT
MYEEYPNQVNLTLPLGVEWVQASDLKITLDRLNTFGDEVFGDAQVLKSYYYAIADIAVGA
RCACNGHAGECVNSTSVDGKTRRVCRCEHNTAGPDCNECLPFYNNAPWGRATTTDAHECK
PCNCNGYSDRCYFDKELYKLTGHGGHCLDCRANRDGANCERCRENYYQRPEDNYCVACNC
NEIGSRSLQCNSEGKCQCKPGVTGDKCNRCAANFYNFGSQGCTSCECSLAGSANNVPNCD
TITGVCVCKENVEGKRCRECRPGFFNLAVDNEFGCTPCFCYGHSSVCRPATGYSKLFIES
MFVRGNERWSASVAGNPIPLHYDALTQTISATALDRDNVYFLAPDKFLGDQRASYNQHIS
FILRIGEAGPAPTARDVILEGGNGEQITQPIFGQNNRLPTVTPQEYKFKLHEHVNYGWQP
RLSSRAFMSILSNLTAIKIRGTYTHQGRGFLDDVKLETAHRGAAGESADWVEHCQCPHGY
VGQFCESCAPGFHHDPPNGGPFALCVPCNCNGHADICEAETGQCICQHNTAGSNCELCSR
GYYGYPLKGTPDDCKPCPCPDNGPCILLGNNPDPICSECPIGRTGPRCETCSDGYYGNPE
KGLACRSCDCNNNIDLNAVRNCNHETGECLKCVNNTAGFHCEECLAGYYGDALSDRKEDG
CKLCQCYPPGTLELDDGRVAPCDQLTGHCACKPHVIGRNCDKCEEGYYHIASGEGCIPCN
CDLEGSYNRTCDPITGQCQCRLGVTGQRCDACEPYQYGFSREGCKPCDCDSIGSQDLQCD
ANGQCPCLTNVEGRRCDRCKENKHNRQHGCVDCPDCYNLVQSAVNDHRRRLAELEDTLYK
INSSPTVIKDSDFEKELKNVQDRIKTLLTTAKQGSGSENKTLVEQLDELREQLNKIDKIY
QTVDVTANDARDITEEGLISIDEAEKVLDKIYEQLTEAEDYLGTDGASALSSAKLRAEQV
GQQNQQMTSIAQEARLLAEINTNEAKKLHMLAEQARNTTMDAYNLAKQTISKYSNITDEL
RNLENKLAQLDDRMDEVKNLTAIAATKSSTVSQEALDLLILDLTLPAVDIEQLRQQIESV
SSESLQIKEQAQLLLEQNENFIKEMTEKIKKSEELLERAQDQQAATAELLAELDEANETA
NDAVKRGDQTLKEAQETLKKLGEFDAEVQRERIKAQSALKDIQKIEELINNANMQAVETE
RVLNGSEGNAKSAREIAQNAQTYADRASTNEKLHLRVDTTDSMIRQYEIQMAKDANITAE
ANYKVGQAKTNVTLASQQVDKALSEVAAIIRELENLPEIDDADLNRLEERLVAAEKEIKA
ANLDQRIRALTDAKNLQTQWVKNYEDEVSRLRIEVENIDDIRKALPTDCYQRVRLEP
Download sequence
Identical sequences F4X4N0
Aech_14484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]