SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_17272 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_17272
Domain Number 1 Region: 458-912
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.44e-126
Family PIWI domain 0.0034
Further Details:      
 
Domain Number 2 Region: 167-477
Classification Level Classification E-value
Superfamily PAZ domain 1.35e-62
Family PAZ domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_17272
Sequence length 912
Comment [mRNA] locus=scaffold121:14684:19303:- [translate_table: standard]
Sequence
MDPNKQPPNEQGRSFLLELMKKRAQMQRSQALSHSLETPSVSSAEQTSRSSEGYSSHASS
SSGGRGRAQLSSWLKSLNSSSSEESRDSSLAIGHGRGAIPRLIRKLGKPSTSFIPESVSK
DDSEGVLGKLADISVYDNPPSPEDLQFSDDIASICRQGKSGMKIEAYCNYVDLILEPGKG
LFQYEIKFSPNIDSIGLRRKLLNQHSVALGRTRIFDGTLLYLPIKLSQNVSHYKSEHPMD
GSKVILTIIFKKKGSMCNVQFFNVLINRIMRALSLVRIGRQNFNPKGAHALPQHRLEVWP
GYVTAVNEYEGGLKLCLDAKHRVMRTETVRDLIREIFQKSHCNYQDAVINEIVGTSVLTR
YNNKTYRIDDVAFNKTPTDTFSKNDEQISYIDYYKTNWNIQIEDVQQPLLVHRDTVRLSN
GEKEERTIYLIPELSYAAGLTDNIRNNHYIMKDLSGVTKMSPNQRRDVVRRFLEEVQRTD
VTREILSEWGLHLSSDLVRFTARQLEPEMIRFGNNKTFKTNERADWSSAAVRNPVLRTPN
LSKWNIIYFIKDRSCIVDFLNQLSKVAIAINMRIDSPKQVALRDDRTETYLREIQNNLTD
NLELLVIVFPTNRTDRYSAIKKLCCVQKAIPSQVIISKTISKPTKLRSITEKIALQINCK
LGGALWTLTLPLKNCMICGIDVYHAGVGGGSRKSVAGFIASLDTQLTKWHSRICMQASKQ
ELVDMLQVCLTSAINAFYKYNGCNPERIIIYRDGVGDGDLDYVENYEVKQLLATFNRIAP
NYKPQLSVIIVQKRINTRIFIKGRDGLDNPAPGTIVDSCITKRNYYDFFLVPQNVRQGTV
TPTHYIVIHDSSNIETDHMQRLTYKLCHLYYNWPGTIRVPAPCQYAHKLVYLVGQNLLSE
PHQSLSDILFYL
Download sequence
Identical sequences F4W6N0
XP_011058876.1.86870 Aech_17272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]