SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_17446 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_17446
Domain Number 1 Region: 22-59
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000055
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_17446
Sequence length 64
Comment [mRNA] locus=scaffold532:33662:33853:- [translate_table: standard]
Sequence
MFVFKFDCEDGSDERFEACKSSCSNDKFQCNNGNCISLLLKCNGIDDCLDGSDERHCLVK
SIYL
Download sequence
Identical sequences F4WYC9
Aech_17446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]