SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_17637 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_17637
Domain Number 1 Region: 23-101
Classification Level Classification E-value
Superfamily Hormone receptor domain 4.19e-19
Family Hormone receptor domain 0.0019
Further Details:      
 
Domain Number 2 Region: 109-427
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000577
Family Rhodopsin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_17637
Sequence length 582
Comment [mRNA] locus=scaffold142:1111309:1134805:- [translate_table: standard]
Sequence
METHRNDVIDRMKLMDDRLESEAKRCDLGNILEPGWCPEIWDGILCWNSTAPGQLAVQQC
ASYIMGFDALAFASKQCMSNGEWYWNVKTDSVWTNFSQCYREPLVTVLMNMSNVETNNAT
LIKKFLPVVKIISKLGYSISLFTLIIAFCILATINLSPIGRRKLRCPRNILHMHLFVSFV
MRAFMALLKDMLFVSGLGVADAVIKVTEGYWLLDEKEIGNWQCKTFTSLWQYFILANYSW
ILMEGIYLHNLVFLALFTDANSSIVYYVIFGWGLPAIFILPWVVTRIIFQDTYCWTTNEK
PLLFLFIRVPTMLSILINFVLFINIVRVLLVKLKSTMSEETERYKRWARSTLVLVPLFGV
HYAFFIFMSYSIGVNETVEVVWLFCDQLFASFQGFFVAVLYCFLNGEVRAEVSRTLRGIK
WTHLRGIRWGQRASTHSVSTCSCNNSKAGGRRHSRRVRWWKSRWKMPSYLYQDRAIRRST
HSMASTQDVGTRGGSLASSRGYLEIAGNGQPPTQPTTQDHHPHHTSPLCSKYTHQSLLSF
CSMSDASGPNVDKIRDHHRWSDSECCHLAYELHNLQQHHGYP
Download sequence
Identical sequences F4W8H2
Aech_17637 XP_011068325.1.86870 XP_011068326.1.86870 XP_011068327.1.86870 XP_011068328.1.86870 XP_011068329.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]