SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_17741 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_17741
Domain Number 1 Region: 186-457
Classification Level Classification E-value
Superfamily Mitochondrial carrier 8.11e-79
Family Mitochondrial carrier 0.0000603
Further Details:      
 
Domain Number 2 Region: 4-160
Classification Level Classification E-value
Superfamily EF-hand 6.87e-37
Family Calmodulin-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_17741
Sequence length 467
Comment [mRNA] locus=scaffold331:688841:713316:- [translate_table: standard]
Sequence
PPPAHYLHELPAQDEERLECLFQRLDLDGNGRIDVHDLSRALRDAGVHTQYAQKFLARSD
RTKSGDISLAEFIHYVREHEKNLRLQFSDLDKNKDGKIDLEELIRAFKELGIEMTQEEAT
KLLQRMDQDGSLNISFNEWRDFLLYAPSTTLLDIIEYWHHTTYMDIGEDIGVPEEFTKGE
MVSGMWWRHLVSGGIAGAVSRTCTAPLDRIKVYLQVHGTRHCNIMSCFRYMLREGGISSL
WRGNGINVLKIGPETALKFMAYEQVKRAIKADNEACELRLYERFCAGSMAGGISQSAIYP
LEVLKTRLALRKTGEFDGMVDAAKKIYRQGGLKSFYRGYIPNLIGILPYAGIDLAVYETL
KNTYLRTHDKKEQPAFWILLLCGTASSTAGQVCSYPLALVRTRLQAEIAPDRSPNTMIGV
FKDILNREGIRGLYRGLTPNFLKVAPAVSISYVVYEHFRQALGVNMT
Download sequence
Identical sequences F4WMY0
Aech_17741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]