SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_17757 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_17757
Domain Number 1 Region: 406-530
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000104
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 340-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000884
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 3 Region: 581-623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000022
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 4 Region: 773-812
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000255
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 5 Region: 735-778
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000367
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 6 Region: 700-752
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000675
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 7 Region: 619-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000907
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 305-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000155
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 264-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000139
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 10 Region: 659-695
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000493
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  Aech_17757
Domain Number - Region: 553-580
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000175
Family Integrin beta EGF-like domains 0.064
Further Details:      
 
Domain Number - Region: 152-308
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0377
Family Growth factor receptor domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_17757
Sequence length 1189
Comment [mRNA] locus=scaffold553:783538:806205:+ [translate_table: standard]
Sequence
QATTASGYFEVQILSLTNNRGTLVDGRCCGGGDGGGKEEFPPCTTPCSTAFWLCLKEYQS
NVTAIGSCSFGNVSSHALGQNTFTLSDPVTLHLHFTFRWTRQFTLILRARDEESAGVIEE
ASYSGIVLPGPTWHTLNHQGKNANLAYRVRVQCADHYYNATCTKFCRPRNDIFGHYTCDE
NGDKVCIQGWKGVDCETAVCKEGCHPVHGHCNVSGECQCRHGWRGELCDQCMPYPGCKHG
YCNGSSWQCICDTNWGGILCDQDLNYCGTHEPCQNGGTCENTAPDQYRCTCPEGFSGPTC
EKIDNPCASNPCLNGATCREFGETAQCECAPGFSGSFCATDIDECASQPCQNGGTCVDGK
NGFVCNCPFAWKGVLCQFDVDECTLKESPCKNSITCINLAGDYRCRCRSGFTGKNCTKNI
NDCVGQCQHGALCIDLVDDYHCSCTPGYSGKDCDVDIDECASKPCQNGGDCRDLVNAYEC
VCPVGFTGYQCEIDRDHCSPNPCRNSAPCFNTQTDYYCHCPTQWQGRNCSEPALNNPQFG
VLDDGQSGCGSEGTPCGGKGRCSGGRCICDPGYTGVHCHENINDCRGNPCLNGGTCVDLL
NSFQCICREGWSGDLCDQNVDDCLTQPCHNNGTCVDGVADFTCICQGDWKGKTCTLRRGH
CDEDTCRNGGDCKDHGDSFTCNCPRGWEGTICHIASPSACTSNPCANGATCVNTVDGSYR
CVCREGFEGPDCRSNVDNCQPVPCLNGGKCVDGDNWFRCECAPGFTGPDCRINVNECASD
PCHGGATCVDGIASYSCICPPGRTGPRCEIRTAGGPGCTAATWEDECNVCECRNGKNQCS
NIWCGPGNCLNGTSCLAHEVCVPSPGESCLAPPCPAWGECRPIETGRRVGPPALPAPPSC
WPGQTTLGPTCSRLTILLRRDTLASGTSVELLCRRLRKLLADPRRPQSVVLLCDLKPGDN
DTIEVTIFSEAAADAARDLGETLSRPLARPLVLVSVLEVKVETALLSEPSLASAANASSY
VTVLGSALAIVLLLVLFGSLWYLKNMRHRSNLTATTSSETSLHRHRSDLDEKSNNLQNEE
NLRRYANPLKDQDSEPRVSVVRPLSGTSLGTLTGTEESLEMVSEEGRHRLPPLYKPPSAE
ARNNTASFSYEEGAHKPYIKPRLQEPMYPHQQPGTSQTSGPHQVLTVHV
Download sequence
Identical sequences F4WYU3
Aech_17757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]