SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_17817 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_17817
Domain Number 1 Region: 263-488
Classification Level Classification E-value
Superfamily YWTD domain 6.67e-35
Family YWTD domain 0.0000163
Further Details:      
 
Domain Number 2 Region: 70-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000223
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 3 Region: 113-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 4 Region: 27-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 5 Region: 179-226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000172
Family EGF-type module 0.004
Further Details:      
 
Domain Number 6 Region: 150-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000218
Family EGF-type module 0.015
Further Details:      
 
Domain Number 7 Region: 495-548
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000838
Family EGF-type module 0.03
Further Details:      
 
Weak hits

Sequence:  Aech_17817
Domain Number - Region: 1-20
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0072
Family LDL receptor-like module 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_17817
Sequence length 552
Comment [mRNA] locus=scaffold532:17985:23626:- [translate_table: standard]
Sequence
MCNGITDCEDGSDEIFDICHNKLQHSLTCSKYEYKCSTNDTCIPKAMFCDTITDCPDGSD
EYDGCVKDLICTKNNFRCNDGRCIFREWICDGRNDCPDGSDELNCSINNCKIENSQYLCE
NQLCIPLKLVCNGKDDCGDKSDEIDCTSSSCPKSIKCDHECTLTSKGNICFCKPGYKLQN
DNRTCIDIDECQTYGICDQECVNSPGSYSCKCQTDYFLQEDNKTCKASGRAKILFSTKTE
IIGMYLTEKNDIEFFNKLTFSNHLISIAVNDEHIYFSKLIGVNEVISKNILMSNMYENVV
TAGLSRISAMAVDWITENLYFTDKINHIGICKFIGIYTNCTVLIDNIDQPMGIALLPTRG
KMYWCDWSSNPHIAVAGMDGKNIRVFVSENIKAPKSLTIDYQTDRLYWVDFKLRTIESIR
LDGTDRRFVLHNITYNPFTLAIFENKLYWIDMKSNAIQSCNKFTGKDRNILFRSLRHPYN
LHIEHPALKPKINNPCLSNPCSELCMLNQENGYSCACTMDKELNIDNHTCQEVTKKQHLL
ITNGYSLVDYYE
Download sequence
Identical sequences F4WYC7
Aech_17817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]