SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g06280.2|PACid:21908047 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g06280.2|PACid:21908047
Domain Number 1 Region: 521-819
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.78e-74
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Weak hits

Sequence:  LOC_Os01g06280.2|PACid:21908047
Domain Number - Region: 210-282
Classification Level Classification E-value
Superfamily PH domain-like 0.000283
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g06280.2|PACid:21908047
Sequence length 894
Sequence
MIKLRSALGVLEILSVLCISLVAAYTPVDNYLISCGSSVDTPVGQRLFVADDSGTVVLTS
PASDAVKASPSAVSGLRDDAAMYQSARVFKAPSSYSFRIRDPGRHFVRLHFFPFVYLGYD
LATASFKVSTQDAVLLDGFAPAAAARGNASTTTTTATAAAVCEEFLLDVARDTLVVTFVP
LAGRLAFVNAIEVVSVPDDLIGAADSSLSTSDSTGQQLNPAVMPLQTVYRVNVGGQAVAP
DSDTLWREWTSDQQLLVGPAMTKGVSYNRTPNYLPGQATANDAPAIVYATGRELIIMTNS
TDDGMKQMAWQFDVGRSASYLIRFHFCDIVSSVPGRLHMNAYVDSSNAIQDLDLSAIGNG
TLAFPYYRDFVLAASTPSGKLAVYVGSTSQKITTPAAILNGLEIMRILTTAGNVAVVEPT
MPPGTKKKNNLAVVLGSVCGAFGFVSVAAALVIVLRRKEEKEELRTPTTSQPSTAWMPLL
GRISFRSAPPSAVGSRSPSFTIDTNANTPGGGATPGMAAAASSSPSYRFPFAALQDATGN
FDEGLVIGEGGFGKVYAAVLQDGTKVAVKRANPESRQGAREFRTEIEMLSGLRHRHLVSL
IGYCDEQDEMILLYEYMEHGSLRSRLYGGGAATATATALSWAQRLEACAGAARGLLYLHT
ATAKPVIHRDVKSSNILLDDGLTAKVADFGLSKAGPDMDETHVSTAVKGSFGYVDPEYVR
TRKLTAKSDVYSFGVVLLEALCARPVVDPRLPKPMVNLVEWGLHWQRRDELEKIVDRRIA
GTVRPAALRKYGETVARCLADRGADRPAMEDVVWSLQFVARLQEVDGLDASDVSSLNMVH
QLMPPTSLHARQRSAGESETGRTDADEDSSVVDDDYTDASMRGIFWQMVNVRGR
Download sequence
Identical sequences Q943P7
39947.LOC_Os01g06280.2 LOC_Os01g06280.1|13101.m00615|protein LOC_Os01g06280.2|13101.m00616|protein XP_015618521.1.37577 LOC_Os01g06280.1|PACid:21908046 LOC_Os01g06280.2|PACid:21908047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]