SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g13070.1|PACid:21907684 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os01g13070.1|PACid:21907684
Domain Number - Region: 392-437
Classification Level Classification E-value
Superfamily PH domain-like 0.00123
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g13070.1|PACid:21907684
Sequence length 442
Sequence
MEQCHHHQQQSNGQQLQRLEGIEEEGGAAEKWPPPTTVRPPETPTETMEFLARSWSLSAA
EISKALRVLSGKGVSDDVHDAAAAVAGDRKERRSPVTMDGRRHEQASEENEAASMRADAS
SMAAAAQGGAMSPPISPRANLDVKLLRATATAAAAAGGRGGGGKTTMGTWIKEQKERKRA
EARSRNAQAYAATSVAGVAAAVAALVAGAVFSPPPDHPKNGGAAAPAPAPAHAAGAAGAK
TAAAIASAAALVASHCVEMAQAIGASHDQILGAIQSAVNAQTSGDIMALTAGAATALRGA
AMLRARLHKEIQAAALPGGGAGAGDISGREPERDTSPFAFVSRGGELLKRTRQGTITVII
KMRSAHMAGTFIKTKKFVVLDICSEIPAWAGREVEEGSHRRGYFGIKTVERMIEFECRSK
YEQHKWVQGITEMLNRRHTMKN
Download sequence
Identical sequences Q9LWR6
39947.LOC_Os01g13070.1 LOC_Os01g13070.1|PACid:21907684 LOC_Os01g13070.1|13101.m01432|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]