SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g22390.2|PACid:21908826 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g22390.2|PACid:21908826
Domain Number 1 Region: 309-559
Classification Level Classification E-value
Superfamily BEACH domain 1.44e-76
Family BEACH domain 0.0000701
Further Details:      
 
Domain Number 2 Region: 1260-1358,1391-1618
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.83e-28
Family WD40-repeat 0.0046
Further Details:      
 
Domain Number 3 Region: 188-276
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-16
Family Protein kinases, catalytic subunit 0.0025
Further Details:      
 
Domain Number 4 Region: 701-788
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000102
Family Protein kinases, catalytic subunit 0.0071
Further Details:      
 
Domain Number 5 Region: 839-1085
Classification Level Classification E-value
Superfamily ARM repeat 0.0000353
Family HEAT repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g22390.2|PACid:21908826
Sequence length 1619
Sequence
MVCSPEKAGAACPECLERRILSGLPGSCFSFVHGLHESPLPFASAAVVQIASDGAEECNG
SQQSTGYFVLVGLQGGKELLDIQECESNSLENGSQIDLQGKESTDADDNHRKQSIINTIT
KLTPTRYLARAATSEIRELISSYLNLTTEESVMNSLNLLSENKIVGSGGLDFLNFTGFSE
FNDIHPSGHVRHPNILPVLGIVETYDCCYMLHPKSPYTLENIMHYSPEALWSDWHIRFLI
YQIISALVYLHDSGVHHGNLKPSAIFMSDSLWPYLSISDICPVKQNCGFAESKRPALTLC
CFEEDCSSRAIYSGFNLSSSLDWQSYSKRWWMGELSNYEYILVLNKLAGRRWGDPAFHTV
MPWVIDFTVRPDENSDIGWRDLTKSKWRLAKGDEQLDFTYSSSEVPHHVSDECLSELAVC
SYKARRLPKNILRSAVRSVYEPNEYPSNMQRLYQWTPDECIPEFYSDPRIFVSLHSEMSN
LALPSWVTSAEEFICLHRNALESDRVSRQLHHWIDITFGYKLSGESSVEAKNVMLPPSDP
AKPKSTGRRQLFTKPHPKRLTSTPHSTYHNKMESCAKCQGGSSSMTTGLLLKDHIPPAMS
SQIDYLEEFEQANVFMKLENHLCPIYDYANDSSSCCSSVKYNKSPCSNQYIVPPESVLSV
APDFDFCSFLECFESDDSSPTGYQELLRWKQKSCSVNEYHANDIFSVGCILAEIYLHGPL
FDADLLSAYKETGILPGAIQELPIHVAVIVESCIQREWKRRPLAKHLLESQYFPPSVRSA
YMFLAPLQLICTPRDRLKYVAKLASEGTLRAMGECAAEMCAPYCLPLVSPSLSYIDTEFA
LALLKEFVKCLSVQATKDLILHIIQKILQAPEYSHLKVSLLQDSFVRELWKKLGKQTYIE
KVHPLVIMNLYNSPNKITASSASIVLIGSSEELGIPITFNQTVLPIIQCFGKGLCPDGID
TLVRIGGLLGESFTVKQILPLLRNVILSCIESSKINKPEPQHSWNSFALMDGLSALEGLV
SILPVKTILRELLQDQVCLHIKVLTQVHLNLRVIQVAASAFVDLCQQIGPENTATYVLPH
LKELFAELAFSHESSGLSVPTKGLKFFDGNKTEPAKMESRIDLVFLLYPFLAALVGIEKL
RECYSTWFLLEQALQRLYGWKPSTDHSGSSENMKGQRFRSGNYTSSEPAPTKLVAEIGKN
GRNMTVSNQGSRLEHGSSSDNLCASTSGNQPWFWFPSPDRNCWAPDFLGRSAGMKDELPW
KIKASVLYSARAHPGALRSLAVHDDECTIFTGGVGPGFKGSIQKWELPNMNCSSGYYGHE
EVVNSICILSITGKVASCDGTIHIWNAQTGKLIAVHTESSISFPQQTASIEQANMLNQDA
LSGGILSNAFRGSLYTTMHYMESKDKLVAGMGNGSIRFIDISQDQKLHLWKSDSDEISFS
SLVSAICSCASDKLKKDSTVASSSWIAAGLSSGYCRLLDERSGNIVAVWRAHDGHITKLA
APEDHLIVSSSLDKTLRVWDLRGNLSTQSNIYRSHSDGIINFSAWGQDMVSVSRNKIALT
SLSRPTSEIGHQQLTFQYLYSSDRGVKYKNMSVLSTISVLPLSRLFVVGTEDGFLKICH
Download sequence
Identical sequences Q5ZDE5
LOC_Os01g22390.2|13101.m02375|protein XP_015621349.1.37577 39947.LOC_Os01g22390.2 LOC_Os01g22390.2|PACid:21908826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]