SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g22390.3|PACid:21908827 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g22390.3|PACid:21908827
Domain Number 1 Region: 157-407
Classification Level Classification E-value
Superfamily BEACH domain 1.23e-76
Family BEACH domain 0.0000701
Further Details:      
 
Domain Number 2 Region: 1108-1206,1239-1466
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.89e-28
Family WD40-repeat 0.0046
Further Details:      
 
Domain Number 3 Region: 36-124
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.9e-16
Family Protein kinases, catalytic subunit 0.0025
Further Details:      
 
Domain Number 4 Region: 549-637
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000919
Family Protein kinases, catalytic subunit 0.0071
Further Details:      
 
Domain Number 5 Region: 687-933
Classification Level Classification E-value
Superfamily ARM repeat 0.0000237
Family HEAT repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g22390.3|PACid:21908827
Sequence length 1467
Sequence
MNSLNLLSENKIVGSGGLDFLNFTGFSEFNDIHPSGHVRHPNILPVLGIVETYDCCYMLH
PKSPYTLENIMHYSPEALWSDWHIRFLIYQIISALVYLHDSGVHHGNLKPSAIFMSDSLW
PYLSISDICPVKQNCGFAESKRPALTLCCFEEDCSSRAIYSGFNLSSSLDWQSYSKRWWM
GELSNYEYILVLNKLAGRRWGDPAFHTVMPWVIDFTVRPDENSDIGWRDLTKSKWRLAKG
DEQLDFTYSSSEVPHHVSDECLSELAVCSYKARRLPKNILRSAVRSVYEPNEYPSNMQRL
YQWTPDECIPEFYSDPRIFVSLHSEMSNLALPSWVTSAEEFICLHRNALESDRVSRQLHH
WIDITFGYKLSGESSVEAKNVMLPPSDPAKPKSTGRRQLFTKPHPKRLTSTPHSTYHNKM
ESCAKCQGGSSSMTTGLLLKDHIPPAMSSQIDYLEEFEQANVFMKLENHLCPIYDYANDS
SSCCSSVKYNKSPCSNQYIVPPESVLSVAPDFDFCSFLECFESDDSSPTGYQELLRWKQK
SCSVNEYHANDIFSVGCILAEIYLHGPLFDADLLSAYKETGILPGAIQELPIHVAVIVES
CIQREWKRRPLAKHLLESQYFPPSVRSAYMFLAPLQLICTPRDRLKYVAKLASEGTLRAM
GECAAEMCAPYCLPLVSPSLSYIDTEFALALLKEFVKCLSVQATKDLILHIIQKILQAPE
YSHLKVSLLQDSFVRELWKKLGKQTYIEKVHPLVIMNLYNSPNKITASSASIVLIGSSEE
LGIPITFNQTVLPIIQCFGKGLCPDGIDTLVRIGGLLGESFTVKQILPLLRNVILSCIES
SKINKPEPQHSWNSFALMDGLSALEGLVSILPVKTILRELLQDQVCLHIKVLTQVHLNLR
VIQVAASAFVDLCQQIGPENTATYVLPHLKELFAELAFSHESSGLSVPTKGLKFFDGNKT
EPAKMESRIDLVFLLYPFLAALVGIEKLRECYSTWFLLEQALQRLYGWKPSTDHSGSSEN
MKGQRFRSGNYTSSEPAPTKLVAEIGKNGRNMTVSNQGSRLEHGSSSDNLCASTSGNQPW
FWFPSPDRNCWAPDFLGRSAGMKDELPWKIKASVLYSARAHPGALRSLAVHDDECTIFTG
GVGPGFKGSIQKWELPNMNCSSGYYGHEEVVNSICILSITGKVASCDGTIHIWNAQTGKL
IAVHTESSISFPQQTASIEQANMLNQDALSGGILSNAFRGSLYTTMHYMESKDKLVAGMG
NGSIRFIDISQDQKLHLWKSDSDEISFSSLVSAICSCASDKLKKDSTVASSSWIAAGLSS
GYCRLLDERSGNIVAVWRAHDGHITKLAAPEDHLIVSSSLDKTLRVWDLRGNLSTQSNIY
RSHSDGIINFSAWGQDMVSVSRNKIALTSLSRPTSEIGHQQLTFQYLYSSDRGVKYKNMS
VLSTISVLPLSRLFVVGTEDGFLKICH
Download sequence
Identical sequences Q5ZDE4
XP_015621352.1.37577 LOC_Os01g22390.3|PACid:21908827 LOC_Os01g22390.3|13101.m02376|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]