SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g23590.2|PACid:21909826 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g23590.2|PACid:21909826
Domain Number 1 Region: 27-123
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000113
Family Ran-binding domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g23590.2|PACid:21909826
Sequence length 388
Sequence
MGEQERREAEGGGGGGEAAAANTSGMQRVKVYRLTDGGKWDDRGTGHVNIDFLEDSKELG
LTVLDEEDNETLLMHNITSEDIYRKQEDTIISWRDPEVATELALSFQEAAGCSYIWDNIC
DIQRNIQFNNLGALEVGPRPTSVSLEASRVLHSNDESFRSVNGELRELPPVELSNLPLIL
KTILEGGITDQMRVAELITQDREFFPKLLDIFRICEDLENLDDLHMIFKLVRGIILLNSS
SIFDKIFSDEFILDIIGALEYDPDVPKVQKHRAFLKDHVVFKEAIPIKNVSVVSKIHQTY
RIGYLKDVILPRVLDDGTLASLNTMIHSNNAAVISLLKDDSCFIQELFARMRLSNISMES
KRELVLFLHEFCTLSKSLPLVQQLRLFR
Download sequence
Identical sequences LOC_Os01g23590.2|13101.m02495|protein LOC_Os01g23590.2|PACid:21909826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]