SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g23590.3|PACid:21909827 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g23590.3|PACid:21909827
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000119
Family Ran-binding domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g23590.3|PACid:21909827
Sequence length 363
Sequence
MQRVKVYRLTDGGKWDDRGTGHVNIDFLEDSKELGLTVLDEEDNETLLMHNITSEDIYRK
QEDTIISWRDPEVATELALSFQEAAGCSYIWDNICDIQRNIQFNNLGALEVGPRPTSVSL
EASRVLHSNDESFRSVNGELRELPPVELSNLPLILKTILEGGITDQMRVAELITQDREFF
PKLLDIFRICEDLENLDDLHMIFKLVRGIILLNSSSIFDKIFSDEFILDIIGALEYDPDV
PKVQKHRAFLKDHVVFKEAIPIKNVSVVSKIHQTYRIGYLKDVILPRVLDDGTLASLNTM
IHSNNAAVISLLKDDSCFIQELFARMRLSNISMESKRELVLFLHEFCTLSKSLPLVQQLR
LFR
Download sequence
Identical sequences Q5Z8F1
LOC_Os01g23590.3|13101.m02493|protein LOC_Os01g23590.3|PACid:21909827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]