SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g42830.1|PACid:21903314 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g42830.1|PACid:21903314
Domain Number 1 Region: 15-146
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-47
Family Necap1 N-terminal domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g42830.1|PACid:21903314
Sequence length 310
Sequence
MSSTGEQSQAKAEAEEAVELVLFQVAECYVYLIPPRKTAASYRADEWNVNKWAWEGTLKV
VSKGEECIIKLEDKNTGELYARAFLREDEPHPVEPVIDSSRYFVLRVEENIDGRQRHAFI
GLGFRERPQAYDFQAALHDHMKYLNKKKTAEEMVQHYEKSSSVDYSLKEGETLVLQLKNK
ESGAKIKSAFFEQGLNKLSFNEKANSKEAPVSLKLPPPPPSPVSPTDSGIAASPFKAEFP
SQDQPAADTGADTTPFKAEFPSSHEQPAADNVASSPPPKAEAAPQEQPTAAEKAPQESVD
DDFGDFQAAG
Download sequence
Identical sequences A0A0E0FPJ2 A0A0E0MZ90 Q5ZDX7
XP_015615791.1.37577 ONIVA01G25810.2 LOC_Os01g42830.1|13101.m04409|protein 39947.LOC_Os01g42830.1 LOC_Os01g42830.1|PACid:21903314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]