SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g50470.1|PACid:21908819 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g50470.1|PACid:21908819
Domain Number 1 Region: 215-601
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.75e-95
Family Regulator of chromosome condensation RCC1 0.00027
Further Details:      
 
Domain Number 2 Region: 6-113
Classification Level Classification E-value
Superfamily PH domain-like 5.16e-24
Family Pleckstrin-homology domain (PH domain) 0.0054
Further Details:      
 
Domain Number 3 Region: 600-667
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.63e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g50470.1|PACid:21908819
Sequence length 1044
Sequence
MTPDETALITLKKGTKLIKYSRRGKPKIRAFRLSSDETSLIWFSHKKEKFLRLSSVTKII
PGQRTAVFGRFLHPEKDYLSFSLIFKNGQRSLDLVCKDQAEVEVWFSALEGLISSFRKKS
LINEHKDRVSFSEEVTYYQDRHSYDSTLDIASNISRSFNSAGYCGTNSFSFRKSDVGFDR
LNMIRTSAADSSRVSISSALSSYSQGSGTDDIESLGDVYVWGEVWTDVTPSDGHTSSSCS
KVDVLIPKPLESDVVLDVNQIACGTRHVALTTRQGEVFTWGEEFGGRLGHGTDADISRPK
LVESLSLTVVDLISCGEFHTCAVTTSGDLFNWGDGSYNVGLLGCGTEVSYWLPKKVSGPL
EGLQVLSVACGSWHSALTTSSGKLYTFGDGTFGVLGHGDRETLAYPKEVEALSGFKTIKV
ACGIWHSAAIVEVTNQTGANVMSKKLYTWGDGDKNRLGHGDKEPRLVPKCVQALLEYNFH
QLACGHNMTVALATSGRVFTMGSSSNGQLGNPKSDGKQPCLVQDRLASELVEEISCGASH
VTVLTSRSEVYTWGMGANGRLGHGDLKDRKKPCLVEALKDRHVKSISCGSNFTTCICIHK
WVSGADQSVCTGCRQAFGFTRKRHDCYNCGLVHCHACSSRKVLKAALAPTPGKPHRVCDS
CFLKLKAAETGSNNSNRRNAVTRRSIDGREKLERPEIRPSRTTAPAESVKYTEVKAARND
MRASQISSLLQFKDLSFSALQPTAMSPAVTMSPAVPALSTPSPYTKKTKSPAPAIPQFPK
TDIDNLQKSNELLNQEMLKLQSQVDSLKQKCEAQHEQLQISDKKTKTVVSMATEEYTRCS
AVVEFVKFLDNELNGIVHELPSDAAESLKALQNQVQALLREQRSHPSELLNPMDHDGIQL
SSGGNALHDFSNHRSGSTRYLFMSQDASSASGSAISLTSEPPSHRGMEHHAKVPNDFVPK
HDTHGEVQLIEQFEPGVYVTLIQLKDGSKVFKRVRFSKKKFAENQAEEWWRENQERVFKK
YSHPTVPQTTSTKTGSSNEEEHHS
Download sequence
Identical sequences Q5N8I7
LOC_Os01g50470.1|PACid:21908819 XP_015619411.1.37577 39947.LOC_Os01g50470.1 LOC_Os01g50470.1|13101.m05250|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]