SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g59800.2|PACid:21908711 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g59800.2|PACid:21908711
Domain Number 1 Region: 264-331
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.72e-22
Family Vacuolar sorting protein domain 0.0094
Further Details:      
 
Domain Number 2 Region: 7-137
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000032
Family VPS36 N-terminal domain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g59800.2|PACid:21908711
Sequence length 333
Sequence
MSAAAADWLPAADVTAAGRPVLTAGEVERHLVAQGDVEPEESPRLGPLRARLLVLTSHRL
IFLHEPSRSARALPLAAVVHAYPPHRKHGHNPLRSIFSSSSSSSSSHHPRVRLQISLPPS
RSEVVAVVVSKGEADVFYGRLLEAVRARAWEVVAAVAAAPAGGSSAAQGAPAEEDLAIRM
PVVGVSGILRMEQEAWESAGQNLQDAFQDLNALMSKAKEMMELAEKMRQKLLTNSSAQSN
SNDEEMGSKQDMQDWLLSVGIVSPVTKETAGALYHQQLSRQLADYIRTPLEKAGGMMALV
DVYCLYNRARGTELISPEDLLQACSLWEKFDVC
Download sequence
Identical sequences LOC_Os01g59800.2|13101.m06361|protein LOC_Os01g59800.2|PACid:21908711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]