SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g45980.1|PACid:21919093 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os02g45980.1|PACid:21919093
Domain Number 1 Region: 149-531
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.44e-90
Family Regulator of chromosome condensation RCC1 0.00042
Further Details:      
 
Domain Number 2 Region: 533-602
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.68e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0024
Further Details:      
 
Domain Number 3 Region: 3-61
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000197
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g45980.1|PACid:21919093
Sequence length 960
Sequence
MALVALKKGAHLLKCGKRGKPKLCPFRLSSDEKMLMWYSKDREKRLNLSSVSSVVLGHKT
VHSIYGSPRLMQKNVLQSNLDFSEPFFSPRQRTWSDLDYYMEKVTPDVVNRVKHSCRDIK
VADKLNEQIITQLPKQKSSEGLHVAYGATSLKDIFVWGEVPGNVLDHGDVSKANVSLPRL
LNTTHIIDVQSVACGEKHAAIVTKQGEVFSWGVDNGGRLGHKVSVSVSDPKIIESLASTR
VKAIAFGAKHTCAVSISGELYEWGEGTHCLGLWGDQYQRSQWFPHKLFGPLDGISILKIA
CGHWHTAIISSAGQLFAYGDGTFGVLGHGDTLTVARPKQVESLKGVRAKAIACGPWHTAA
IVERMGTVKSNAPSGKLFTWGDADRGKLGHADKKMKLVPTCVEPLNDFDFAQVSCAKAQT
IVLTITGVVFTIGSKEHGRLGNPLSEDTSICLIEGPLKTEFVREISSGSSHIAVLTMNGK
VFTWGKGTEGQLGLGDYVDRSYPTLVEALEDKQVHSIACGFNFTMAICLHRPLSSKDQSV
CSNCQLTFGFTRKKHNCYNCGSMFCNSCSNNKVSRAALAPDRSKRYRVCDACFSQMQKVE
EHRKLDPQQKIQKDEVCPIEIRSYTPKLARIFKEANAIMEKMASAQSPHQRSQNLAVPDH
VRTLRWGLVECPSQFRCVRESIPYCSTLNKQTVSGSIVRVMNETMAPKPASSLLKSANDS
KAELDLMENILLEEVKQLQEQVTTLAKQCRQRSLKVQLYKRKVEETWLIAKDEAAKCKAA
KDIIKVLIDQHDFLSKNLLAGEKLDNSRIMPSHIASAKSLKAELPDPPDKNVFTSEFQQS
KSNRDHHNSRQVDRECTQPSIASMANYSVTHQNCRRTSNGSTRCTEGTDATTAPTDSNGV
IEQIERGVYATVVTSPGGKKCIKRIRFSRKHFGEDQAQKWWEANESMIFGKYSSMEQTVG
Download sequence
Identical sequences LOC_Os02g45980.1|PACid:21919093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]