SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g50440.1|PACid:21923608 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os02g50440.1|PACid:21923608
Domain Number - Region: 30-119
Classification Level Classification E-value
Superfamily BEACH domain 0.0225
Family BEACH domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g50440.1|PACid:21923608
Sequence length 160
Sequence
MTPPLRRASVRYFRPLTILRMMPEGYIRHISTQWSSYDYCLVLDQRCSDFSHYLYFNKVG
SRPPRNLRDLRLGTPRADKALSDPVETKYHDPPHTMSYTETDFRYGGSSNKERQPEFYME
TTRTTRIVSILVSLVLLGQGDTYGYKYRAPRRRGENNHPR
Download sequence
Identical sequences Q6Z732
LOC_Os02g50440.1|PACid:21923608 LOC_Os02g50440.1|13102.m05725|protein 39947.LOC_Os02g50440.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]