SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g18180.1|PACid:21914085 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g18180.1|PACid:21914085
Domain Number 1 Region: 31-158
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-43
Family Ran-binding domain 0.0000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g18180.1|PACid:21914085
Sequence length 209
Sequence
MADPAEHREEEEEAAAAAAGEDEDTGAQVAPIVKLEEVAVTTGEEDEEVLLDMKSKLYRF
DKEGNQWKERGTGTVKLLKHKETGKVRLVMRQAKTLKICANHLVATTTKMQEHAGSDKSC
VWHALDFADGELKEEMFAIRFGSVENCKKFREMVEEIAEQQGKNEEKENEEVSSTAGLVE
KLSVTETKKEENAEKEETPAEEDKKDAKE
Download sequence
Identical sequences A0A0D9Z5U2 A0A0E0GL38 A0A0E0NTP8 B8ALM1 Q10MW8
OsIBCD009771 XP_015627830.1.37577 LOC_Os03g18180.1|PACid:21914085 39946.BGIOSIBCE010701 39947.LOC_Os03g18180.1 ONIVA03G14840.1 LOC_Os03g18180.1|13103.m02177|protein OGLUM03G13680.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]