SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g46480.2|PACid:21916300 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g46480.2|PACid:21916300
Domain Number 1 Region: 213-356
Classification Level Classification E-value
Superfamily PH domain-like 1.93e-17
Family Ran-binding domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g46480.2|PACid:21916300
Sequence length 360
Sequence
MMAGPATLDPQRAEAANKHVRALNSQFASWVQSQLQNHPAELWEDGMRDYISHASEIMEK
FKDVVNWIRQNKTGSAVVLSPGPPNDEKTISPAAVDSKFTVQSSPDNGQKGPVTAASSPA
FQNSSSPNLFSFASHQKTPAFTGIFGDKKNMPGDSNKPSFQFGANNGFSTPSMPSIFSAS
GAQSFSMPSQTLFSVNQQPAISGNKSAAEASGDADEDAEPEQPSSPSVKKAEEKGIVVVY
EAKCKVYVKHDDPANGWKDIGVGQLNIRCKEGAEKASKESTPTIVIRNDVGKILLNALIY
KGIKMNVKKSTVASIFHTSDGQPSESGSATVVARTYLIRVKNDEAAAKLSAAIMENAPLE
Download sequence
Identical sequences Q10FH4
LOC_Os03g46480.2|PACid:21916300 LOC_Os03g46480.2|13103.m05005|protein XP_015628127.1.37577 XP_015628128.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]