SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g62080.1|PACid:21916260 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g62080.1|PACid:21916260
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000566
Family Dcp1 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g62080.1|PACid:21916260
Sequence length 387
Sequence
MNRKNTENLTEDLLGGFEYQVQVPYIMYHNAADEITGIWFYDPQECEQVGYLFSRIQKAF
SRVSPKAKVSVTESEYEKPEVVPAVPSNEDTLKQPTSSIMLLDNAKYDFLSALLKGAACV
GATMDEASAVQSNKSVGMVHSSTHASPHAIPPQSPAIQSNKSFGMVHSSTQAPLAIPPQS
PAIRSNKSVGMIHSSTHASPFDIPPQSPAVQSNKSVGMIHSLTHASHLAIPPQSPALHGL
HPSQISAVPVMPHDAHRSSSTSTIQPTSLANPLFFPPMPSLQTASHAASSLCSAAPLHPP
ITVQQLQSAPLHQPFSLPTASSIQPPYGMPLLQPFPPPNPSPFLTSGVSYGRPVITRDQL
KDVLLSLCQNDEFIDMIYREFVKRQLP
Download sequence
Identical sequences Q10AY3
LOC_Os03g62080.1|PACid:21916260 39947.LOC_Os03g62080.1 XP_015629175.1.37577 LOC_Os03g62080.1|13103.m06850|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]