SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os04g46894.1|PACid:21893815 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os04g46894.1|PACid:21893815
Domain Number 1 Region: 1961-2189
Classification Level Classification E-value
Superfamily BEACH domain 4.84e-103
Family BEACH domain 0.000000081
Further Details:      
 
Domain Number 2 Region: 1846-1946
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000135
Family PreBEACH PH-like domain 0.0027
Further Details:      
 
Domain Number 3 Region: 185-325
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000198
Family Clostridium neurotoxins, the second last domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os04g46894.1|PACid:21893815
Sequence length 2197
Sequence
MAVGIHATLRACTRNRAMCSSSGLLPVLLDSAEKLLIGMGRASSWDGTPLLHCIQLLGGH
SLSVKDLHSWLGLVKKALGTSWATPLMLALEKAMGSEEARGPAATFEFDGESSGLLGPGD
SRWPFSNGYGFATWIYIESFSDTLSTATAAAAIAAAAAATSGKSSAMSAAAAASALAGEG
TTHMPRLFSFLSSDNQGVEAYFHGQFLVVESGGGRGKKASLHFTYAFKPQRWYFVGLEHT
NKHGLLGKGDSELRLYVDGSLHESRPFEFPRISKPLAFCCIGTNPPPTIAGLQRRRRQCP
LFAEMGPIYIFREPIGPERMGRLASRGGDVLPSFGNGAGLPWRATNDHVKNMAEESFTLN
QQIGGCLHLLYHPSLLNGRLCPDASPSGSAGTHRRPAEVLGLVHVSSRVRPAESLWALAY
GGPMALLPLTISNVQMDSLEPMLGELSIATASLSAPIFRIISLAIQHPGNNEELCRTCSP
EILSRVLHYQLQAFPKMEGGEGEAVTDEELVDAIVSLCQSQRNNHELKVQLFSTLLLDLK
MWSSCTYGLQKKLLSSLADMIFTEAACMRDANALQMLLDSCRRCYWAIREPNSIDNFALT
GTKRSLGEINALIDELLVVVELLLGSASSTAASDDVRCLIGFVVDCPQPNQVARVLHLIY
RLIVQPNISRANMFAQSFISCGGVDALLVLLQREAKAGNNSILDNSDALLSENDFLRNDD
SDTKAASGEAKSQDDQIQSVELEQHESILHEEHTELGSTSTNDVPCEILGSSIGRKLSSS
ENQLLKNLGGINFSITADNVRNNVYNVDKGDGIVVGIIHILGALVASGHLKFASRAANPN
LPGGLLTTVHEEGNTMSEDRVSLLLFALQKAFQAAPRRLMTVNVYMALISAAINVSSVDE
NLNLYDCGHRFEHIQLLLVLLRSLPYASRSFQSRAIQDLLFLACSHPENRTTMTSISEWP
EWILEVLIYNHEMGAKKYADGISIGDIEDLIHNFLIIMLEHSMRQKDGWKDVEATIHCAE
WLSMVGGSSTGDQRIRREESLPILKRRLLGGLLDFSARELQVQTEVIAAAAAGVAAEGLS
PEEAKTQAENAAHLSVALAENAIVILMLVEDHLRSQGQHFCTSRSLDSAVPSASMVSSAA
SRSNSLCRSGNEPMDAGTSRRSSLSTDAGGLPLDVLTSMADSNGQISAAVMERLTSAAAA
EPYESVKHAFVSYGSCIADLAESWKYRSRLWYGVGIPSKSDTFGGGGSGWEFWKSVLEKD
SNGTWVDLPLVKKSVAVLQALLLDDSGLGGGLGIGGGSGPGMGVMTALYQLLDSDQPFLC
MLRMTLVSMREDDNGEGDAFTGNISIKDVISEGLGHQAGSMMPLDSNNRSSTRKPRSALL
WSVLGPILNMPINESKRQRVLVASSILYSEVWHAIGRDRSPLRKQYIELILPPFIAILRR
WRPLLAGIHELTSSDGQNPLIADDRALAADALPIEAALSMISPGWAAAFASPPVALALAM
MAAGASGTEAIAPPRTLNRRDTSVPERKAAPKLQSFTSFQKPIETAPNKHGSTPKDKAAV
KAAALAATRDLERTAKIGSGRGLSAVAMATSGQRRSAGDIERAKRWNTSEAMSAAWMECL
QSVDSKSVSGRDFSALSYKYVAILVSGFALARNLQRVEMERQTQADVLNRHRVSTGVRAW
RHLLHCLTEMDRLYGPFGEPLCAPDRIFWKLDFTESSSRMRRFMKRNHKGSDHLGAAADY
EERKLSNVAQSNECNPEGTEPLVTDTLPSTAPIITAEAMSVDDRNEDNEQLESDTTQSSV
DDRLQQADQQSVKGSIDSRGSGISADRNLVRSTVIAPGYVPSDADERIIVELPSSMVRPL
KVVRGTFQVTSKRINFIIDESASESNMDDHASTSGQCDQQDKDRSWLISSLHQIYSRRYL
LRRSALELFMDMEARKNAYRAIVHSKPPNLNDIFLATQRAEQILKRTQLTERWANWEISN
FEYLMELNTLAGRSYNDITQYPVFPWIIADYRSEILNLDDPCTYRDLSKPIGALNPERLE
KFQERYSTFEDPIIPKFHYGSHYSSAGTVLYYLFRVEPYTTLSIQLQGGKFDHADRMFSD
LSGTWDSVLEDMSDVKELVPEMFYLPEVFTNINSIDFGTTQLGGKLDSVNLPPWAEDPVD
FVHKHRKALESEHVSAHLHEWIDLIFGYPHFPFFFLI
Download sequence
Identical sequences LOC_Os04g46894.1|PACid:21893815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]