SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os04g57140.1|PACid:21893108 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os04g57140.1|PACid:21893108
Domain Number 1 Region: 819-1168
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.84e-120
Family Motor proteins 0.0000000000989
Further Details:      
 
Domain Number 2 Region: 294-411
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-21
Family Second domain of FERM 0.0024
Further Details:      
 
Domain Number 3 Region: 416-504
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000111
Family Phosphotyrosine-binding domain (PTB) 0.054
Further Details:      
 
Domain Number 4 Region: 760-840
Classification Level Classification E-value
Superfamily Prismane protein-like 0.0000201
Family Acetyl-CoA synthase 0.021
Further Details:      
 
Weak hits

Sequence:  LOC_Os04g57140.1|PACid:21893108
Domain Number - Region: 192-242
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0548
Family Ubiquitin-related 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os04g57140.1|PACid:21893108
Sequence length 1195
Sequence
MQKQIHSAGKRGFFSKKSVGPHVREKFTLEDMLCFQKDPIPTSLLKISSDLVSRSIKLFH
VILKYMGIDSPAIISLDERIELVAKLYKHTLKRSELRDELFAQISKQTRNNPDRAWLIRA
WELMYLCASSMPPSKDIGAYLSEYVHYIAHGATTDSDVRVLALNTLNALKRSVKAGPRVT
IPAREEIEALLSSRKLTTIVFFLDETFEEITYDMATTVADAVEELAGIIKLSVYSSFSLF
ECRKVVNGSKSSDVGNEEYIGLDDNKYIGDLLSEFKAAKDRNKGEILHCKLVFKKRLFRE
SDEAITDPMFVQLSYVQLQHDYILGNYPVGRDDAAQLSALQILVEIGFVDNPESCVEWIS
LLERFLPRQVAITRAKRDWELDIVSRYQLMEHLSKDDARQQFLRILRTLPYGNSVFFSVR
KIDDPIGLLPGRIILGINKRGVHFFRPVPKEYLHSAELRDIMQFGSSNTAVFFKMRVAGV
LHIFQFETKQGEEICVALQTHINDVMLRRYSKARSATSAVSQNDVSQTYKPPNIEIYEKR
VQELSKAVEESERKADLLNEELQKKTKQERDMQKELEGLRDTLQSERQSIKEVTNDLDKL
KSLCDEKDSSLQASLMEKTRLETRLKSGQGQESSNRTGVSGNHFERDTLPTVGTVNNSIE
MLAKLEEELKSCKKELDASKELSKKLTMENNLLDQKVQRLERAKSEEKSNMERVYEDECC
KLKSRIAELEQKLESRTRSLNVTESTLALRNAEVDTLQNSLKELDELREFKADVDRKNQQ
TAEILKRQGAQLIELENLYKQEQVLRKRYYNTIEDMKGKIRVFCRLRPLNDKELIEKDKN
IVCSPDEFTVAHPWKDDKSKQHIYDRVFDANTTQEEVFEDTKYLVQSAVDGYNVCIFAYG
QTGSGKTFTIYGSENNPGLTPRATSELFRVIKRDGHKYSFSLKAYMVELYQDNLVDLLLA
KNATHQKLEIKKDSKGVVTVENVTVVNISSFEELRAIILRGSERRHTAGTNMNVESSRSH
LILSIIIESTNLQTQSYARGKLSFVDLAGSERVKKSGSAGKQLKEAQSINKSLSALADVI
GALSSDGQHIPYRNHKLTMLMSDSLGGNAKTLMFVNVSPAESNLEETYNSLMYASRVRCI
VNDTSKHVAPKEIMRLKKLIAYWKEQAGKRSEDDDLEEIQEERTPKEKADNRLTS
Download sequence
Identical sequences LOC_Os04g57140.1|PACid:21893108 LOC_Os04g57140.1|13104.m05961|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]