SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os05g08970.1|PACid:21941073 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os05g08970.1|PACid:21941073
Domain Number 1 Region: 204-440
Classification Level Classification E-value
Superfamily PH domain-like 8.85e-77
Family SSRP1-like 0.00000695
Further Details:      
 
Domain Number 2 Region: 544-626
Classification Level Classification E-value
Superfamily HMG-box 6.02e-24
Family HMG-box 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os05g08970.1|PACid:21941073
Sequence length 640
Sequence
MTDGHHFNNISLGGRGGNNPGQFKLYSGGLAWKRQGGGKTIEVEKSDITSVTWMAIPRSY
QLGVSTKEGLFYRFFGFREQDISSLTNFMEKNMRITPEEKQLSVGGHNWGGIEINGNMLS
FNVGSKEAFEVSLADVAQTQMQGKTDVVLEFHVDDTTGGNEKDSLMDLSFHVPTSNTQFP
GDENRPSAQVLWQAILNKADVGSSEEAVVTFDGIAILTPRGRYSVELHLSFLRLQGQAND
FKIQYSSILRLFVLPKSNNPHTFVVITLDPPIRKGQTLYPHIVIQFETEAVVQRDLTLSD
EVLAEKYKDRLENSYQGLIHEVFSKVLRGLSGAKVTRPSTFRSCQDGYAVKSSLKAEDGL
LYPLEKGFFFLPKPPTLILHEEIEYVEFERHGAGGASISSHYFDLLVKLKNDQEHLFRNI
QRNEYHNLFNFISGKHLKILNLGEAQGRAGGVTAVLQSTDDDAVDPHLERIRNQTGDDES
DEEDEDFVADKDDSGSPTDDSGEEGSDASLSGGEKEKSSKKEASSSKAPLKKRKPKGGDA
AEGSEKRKPKKKKDPNAPKRAIAPFMYFSKAERANLKNSNPELATTEIAKKLGERWQKMT
AEEKQPYVEQSQVDKKRYAEESAAYRGAAAMDVDSGPASD
Download sequence
Identical sequences A0A0D3G3Z1 A0A0E0PIC5 A2Y138 Q65WY8
39946.BGIOSIBCE017808 39947.LOC_Os05g08970.1 LOC_Os05g08970.1|PACid:21941073 OBART05G05520.1 XP_015637672.1.37577 OsIBCD016679 LOC_Os05g08970.1|13105.m00995|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]