SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os05g20880.1|PACid:21941558 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os05g20880.1|PACid:21941558
Domain Number 1 Region: 8-109
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.53e-30
Family Retroviral integrase, catalytic domain 0.0099
Further Details:      
 
Weak hits

Sequence:  LOC_Os05g20880.1|PACid:21941558
Domain Number - Region: 121-161
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0575
Family Mitotic arrest deficient-like 1, Mad1 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os05g20880.1|PACid:21941558
Sequence length 187
Sequence
MYAKNVEIFDVWGMDFMGPFHKSRNCEYILVAVDYVSKWVEAMPCNTADARHAKKMFTEI
IFTRFGIPRMVISDGGSHFIDKTFQDLLREMGAKHNVATPYHPQTSGRVPGQYQEDEVKS
SEPSIHKLAVQVKKLRKENIELRDRNTELGVELAEIRNNFDTLSRGLCAKIKRAFVEMGK
ENKYYAN
Download sequence
Identical sequences LOC_Os05g20880.1|13105.m02206|protein 39947.LOC_Os05g20880.1 LOC_Os05g20880.1|PACid:21941558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]