SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os05g29050.1|PACid:21938676 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os05g29050.1|PACid:21938676
Domain Number 1 Region: 160-328,371-417
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 6.8e-40
Family Phospholipase D 0.058
Further Details:      
 
Domain Number 2 Region: 558-777
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.36e-28
Family Nuclease 0.051
Further Details:      
 
Domain Number 3 Region: 70-180
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000222
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os05g29050.1|PACid:21938676
Sequence length 934
Sequence
MQEYLNHFLGNLDIVNSPEVCKFLEVSCLSFLPEYGPKLKEDYVSVGHLPKIQKDHKENC
CSCGLFSCCKSSWQKVWVVLKPGFLALLKDPFDPKLLDVLIFDALPHMDISGEGQISLAK
EIKERNPLHFGLQVSSGGQTLKLRTRSSSKVKDWVSAINAARQTPEGWCYPHRFGSFAPP
RGLMPDGSMVQWFIDGEAAFQAIASSIEQAKSEIFITGWWLCPELFLRRPFQHHGSSRLD
ALLEARAKQGVQIYILLYKEVALALKINSLYSKQKLLNIHENVKVLRYPDHFSSGVYLWS
HHEKIVIVDNQVCYLGGLDLCFGRYDNSAHKLSDVPPVIWPGKDYYNPRESEPNSWEDTM
KDELDRTKYPRMPWHDVQCALYGPPCRDVARHFVQRWNYAKRNKAPNEQGIPLLMPHHHM
VIPHYKGIGQEINSEADGKQNHDKDCDVKKPVSVDSRESCQDIPLLLPQELEPPALPNGD
LRVNDLDANHSDHLHKTSFNQPLLNRKAKLDSSRQDLPMRGFVDNISSLESSSIRHFDSS
KEEKYHMDKNWWEMQERGDQVASVLDIGQVGPRATCHCQVIRSVGQWSAGTTQIEGSIHN
AYFSLIEKAEHFVYIENQFFISGLSGDETIKNRVLEALYRRILRAEREKKRFKAIIIIPL
LPGFQGGIDDGGAASVRAIMHWQYRTICRGPNSILQNLYDVIGPKAHDYISFYGLRAHGR
LCEGGPLVTNQIYVHSKLMIIDDRITLIGSANINDRSLLGSRDSEIAVVIEDKEVVSSKM
NGKPWEAGKFSLSLRLSLWAEHLGLHRGEVSHIMDPIDDSTFKNIWMATAKTNTMIYQDV
FSCVPNDLIHSRAQFRQSFAHCRDKIGHNTIDLGVAQEKLETYQDGDLKGTDPIERLQMI
KGHLVSFPLDFMSQEDLRPYFSESEYYTSPQVFH
Download sequence
Identical sequences XP_015640456.1.37577 LOC_Os05g29050.1|13105.m03003|protein LOC_Os05g29050.1|PACid:21938676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]